SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20089734|ref|NP_615809.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20089734|ref|NP_615809.1|
Domain Number 1 Region: 1573-1882
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.54e-39
Family Integrin alpha N-terminal domain 0.0035
Further Details:      
 
Domain Number 2 Region: 12-299
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.09e-34
Family iota-carrageenase 0.065
Further Details:      
 
Domain Number 3 Region: 1884-1977
Classification Level Classification E-value
Superfamily PKD domain 4.45e-31
Family PKD domain 0.00021
Further Details:      
 
Domain Number 4 Region: 484-749
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 9.42e-31
Family Quinoprotein alcohol dehydrogenase-like 0.0061
Further Details:      
 
Domain Number 5 Region: 1980-2062
Classification Level Classification E-value
Superfamily PKD domain 1.57e-30
Family PKD domain 0.00026
Further Details:      
 
Domain Number 6 Region: 310-394
Classification Level Classification E-value
Superfamily PKD domain 5.49e-30
Family PKD domain 0.0003
Further Details:      
 
Domain Number 7 Region: 835-925
Classification Level Classification E-value
Superfamily PKD domain 6.93e-29
Family PKD domain 0.00024
Further Details:      
 
Domain Number 8 Region: 924-1010
Classification Level Classification E-value
Superfamily PKD domain 2.35e-28
Family PKD domain 0.00025
Further Details:      
 
Domain Number 9 Region: 1094-1179
Classification Level Classification E-value
Superfamily PKD domain 6.41e-27
Family PKD domain 0.00028
Further Details:      
 
Domain Number 10 Region: 752-839
Classification Level Classification E-value
Superfamily PKD domain 1.01e-26
Family PKD domain 0.00024
Further Details:      
 
Domain Number 11 Region: 1013-1095
Classification Level Classification E-value
Superfamily PKD domain 2.62e-26
Family PKD domain 0.00031
Further Details:      
 
Domain Number 12 Region: 1183-1268
Classification Level Classification E-value
Superfamily PKD domain 8.24e-21
Family PKD domain 0.00064
Further Details:      
 
Weak hits

Sequence:  gi|20089734|ref|NP_615809.1|
Domain Number - Region: 387-504
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000268
Family Serum paraoxonase/arylesterase 1, PON1 0.093
Further Details:      
 
Domain Number - Region: 2224-2273
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0149
Family Type I dockerin domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20089734|ref|NP_615809.1|
Sequence length 2275
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MNKGIFLILFALICIVLIGPAEAKTWYVDDSGEADFTDIQTAVNSASSGDTIFVYSGTYS
GFYVNIPYLSIIGEGADVVTVGSSIYLPEGSSAWQNATGTVLQEMKITASPMIGYSSLGT
VSDITIRDCTFEGISSSIAVYLRSTNRVVFENNVISNCTGNNALVAKGDSCIITNNSIQN
NKNAYAIVFYQATNTTVKNNHIESNNIGFYFNNAGNENKIYLNSLSNNSQSVKVAGTVPS
ITYWSSPDQILYTFNSTTYTGYMGNYWSDYTGTDANGDGIGDDPYVLPDSLEADNYPLMQ
PFENYFGGSDPVVPVAAFTASPTSGDAPLAVNFTDTSTGSPTSWFWDFGDGDDTNSTVQN
PFHVYTSSGIYNVTLTVTNDEGSDTETKTGYITVTSGGTNSGLADSAWPKYGYDLSNTGQ
SPYAGPQTNNVIWTLDVGGSYRAVSPSIGADGIIYVGSQFDHKLYALYPDGTEKWSYSGS
TYFSSPTIGSNGTIYVGSMDSNLYALNPDGTLKWSFATGGEIYAAPAIGSDGTIYIGSND
DKLYALNPDGTEKWNYTAGNDFRYGSPAIGPDGTVYAGNMDNNVYALNPDGTLKWSYTTG
GYVLSGPAIGSDGTIFAGCYDYNVYALNPDGTLKWSYTTGGHIFNIPAIGSDGTIYIGCQ
DKNLYALNPDGTEKWKYLLSNSVTYSSPVIGSDGTIYLGVRNSVGNYFHAINPDGTEKWK
YLTGSTIQSPSVIGSDGTLYVVMDNRLLYAFRDTEAEPSVADFSADLTSGTTPLTVQFTD
LSENSPLAWTWDFGDGDDTNSSKQNPVHTYTAAGTYTVTLTAINSGGKGTESKVGYITVT
DAVPPVAEFSAEPTSGEIPLTVRFTDESTGYPTEWFWDFGDGDDTNATVQNPVHTYAEVG
TYTVTLTATNSVGNDTESKTSYITTTCFAPVADFSAEPTSGKVPLTVHFTDESANNPTSW
SWDFGDGDDTNSTLQNPVHTYAEIGIYNVTLTATNTAGNGTESKTGYITVADTVPIAHFS
AEPTCGEVPLTVQFTDLSENFPASWSWDFGDGDDTNSTLQNPVHTYAEIGIYNVILTATN
TAGNGTESKTGYITVVTTPVANFSGEPTSGKVPLTAQFTDLSENFPDSWSWDFGDGDDTN
ATMQNPVHTYIASGTYTVNLTVTNDAGNDTEEKTGYITVESLVPGEDAPVSSFTTNSSSG
RVPFIVQFTNTSTGNVTGLSWDFGDGETSTEKNPVHTYVTQGTHTATLAATGPGGTTKAT
ETMEVAAPLNTGSYDGGSPLLTVQEGNVSGGLWYDSYPGFDTYAEKTFTLPDHTAIKWAR
LYADVYCGLMDGNKSFSMTIDIDGDGDGTYELQKYDAASIGYSGTPVWVNDHVNRVTSDY
FMWYDLTDDITGNEVNIKATGGGDDGRIKHVTLVVAYDDGDKDEIHYWVNQGHDTANYDS
YIGSTEFGTSALSDDPNAVNLSSIYCASVDGVYTFDGESLASGGPAISGGYFGYNDWGVT
EYFNSGQDSTLTYANTGGGYYKIQVALLTASNISSSGSNAPVAAFSATPTSGHTPLTVQF
TDESSNSPTSWSWDFNGNGTVDSTEQSPSYLYTVAGTYTVNLTVTNGDGSDSEVKSDYIT
VTAPPASGPEWTLNSNWNTPDIGKYSSPAFADIDSDGDYDLMIGAYDGVTYCYENTGSSG
SPEWTLNSNWNAPAVGFVISSPALADLDGDGDYDLMIGAYDAVTYGYENTGTSGSPVWTA
NTSWNAPYIGSITASPALTDLDGDGDFDLLIGSKSGVTYGYENTGSSDSPEWTLNSNWNA
PAVDTYSSPALADLDGDGDYDLLIGSMSGVTYGYENIGSSGSPEWTLYSNWNAPDAGAKT
SPALADLDGDGDYDLMIGESTGVTYGYENTETTGVTVPVAGFSASPTSGTAPLMVQFTDN
STGSPTEWSWDFGDGATSNESSPMHTYSAAGNYTVNLTVENSAGTDFEVKTDYITVLEPS
TPEPVAAFTADVTNGDVPLTVNFTDQSTGSPASWLWDFGDGATSTEQNPVHTYASAGSYT
VNLTVENGAGTDFELKSDYIEVSKASGSTVTLYFDPASSSVSENESTEISIIASNFPAGF
SGYNLTVALDNPAVAEIVDIKYPTWALITENSSLPGTSIYLKTVDLEDAIKEGAADVVLA
TLTVSGKEKGSANLSIGVKRLEEDSGDTIEPALLAGTIEVTLLSPLPDQEYAPKDLDGDG
LYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVDMFAMI
Download sequence
Identical sequences Q8TSE8
MvR111 188937.MA0850 gi|20089734|ref|NP_615809.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]