SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20089735|ref|NP_615810.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20089735|ref|NP_615810.1|
Domain Number 1 Region: 2270-2353
Classification Level Classification E-value
Superfamily PKD domain 6.28e-31
Family PKD domain 0.0003
Further Details:      
 
Domain Number 2 Region: 2067-2184
Classification Level Classification E-value
Superfamily PKD domain 3.01e-30
Family PKD domain 0.0003
Further Details:      
 
Domain Number 3 Region: 1777-1861
Classification Level Classification E-value
Superfamily PKD domain 6.67e-30
Family PKD domain 0.00022
Further Details:      
 
Domain Number 4 Region: 1333-1415
Classification Level Classification E-value
Superfamily PKD domain 2.22e-29
Family PKD domain 0.0002
Further Details:      
 
Domain Number 5 Region: 2180-2265
Classification Level Classification E-value
Superfamily PKD domain 3.53e-29
Family PKD domain 0.00018
Further Details:      
 
Domain Number 6 Region: 1221-1330
Classification Level Classification E-value
Superfamily PKD domain 2.09e-28
Family PKD domain 0.00024
Further Details:      
 
Domain Number 7 Region: 1416-1501
Classification Level Classification E-value
Superfamily PKD domain 3.14e-27
Family PKD domain 0.00046
Further Details:      
 
Domain Number 8 Region: 677-791
Classification Level Classification E-value
Superfamily PKD domain 3.92e-26
Family PKD domain 0.00036
Further Details:      
 
Domain Number 9 Region: 795-878
Classification Level Classification E-value
Superfamily PKD domain 9.94e-22
Family PKD domain 0.00047
Further Details:      
 
Domain Number 10 Region: 2012-2092
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000000235
Family Invasin/intimin cell-adhesion fragments 0.0051
Further Details:      
 
Weak hits

Sequence:  gi|20089735|ref|NP_615810.1|
Domain Number - Region: 2512-2563
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00255
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20089735|ref|NP_615810.1|
Sequence length 2566
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MKRIFLILCIAALMCMTSLAAPVLAGNNTDSQASDAQLMNVHIPFIQNQGQHPEAVKFYA
DTFYGTAYITDTDLTHSVAVTKDNVTSGVALKEQFVTVEGTVISLIPEGEDPAETKVSYF
LGNDSSKWQTGLPTYNLVSLGELYPGITVSAKAHGNNVEKLFSVAPGANPNNIRVKVLGA
DSIHVADDGSLVVTTGDGDVTMAAPKAFQDGESVKVSYRVLDYGTYGFSVGEYDQSRTLL
IDPFLNFSTYVGGSADDRGYSIAVDNSDNIYITGTTTSTDFPYTVGAYNTSSSGGNDVFV
TKFDSSGNQVYSTYIGGSSNDFGYSIAADSANNAYITGYTSSQDFPITTGAYQTAHGGGT
YDVFVTKLNTDGTDLVYSTYLGGGSSYDYGFGIAIDSANNAYITGYTNSANFPTTTSAYQ
TSNSGMDTFVTKLNTDGTGLVYSTLLGGSLYDYGYGIAVDNNGDAYVTGSTLSTNFPVTS
GSFQTSPGESSGSFDAFVTKLNSDGTGLVYSTYLGGSDTDNGYGIALDNAGNAYITGTAK
STNFPISQGAYKTGKTGFFDIYVSKLNPEGTILEYSTYLGGAVWGASGGSNGYYYRNILV
DSEGNAYIAGTAQSYYEYPVTSEAYQTAKQGGDDPVVTELNPDGTGLVYSTYLGGSGNDY
GSGIAADSQGNIYIVGYTASTDFPVNSNAYQNASSGSYDVFVSKLDLKLPVAAFSANVTS
GDNPLIVQFTDQSTSGIPISWAWDFNNDGSIDSIEQNPRYTYTIPGNYTVNLTVTNSQGS
DSEVKADYISVSGSVLPPVADFTSDVTTGIAPLTVHFSDISTGSVNSVAWDFNNDGITDS
TFQNPVYTFETNGIYTVNLTVTGPSGSDSEVKRDYINVISNVDLTVSTNPTLYPSNNNTV
TATVTNIGTENSPAFSVNFLIDGINMTAEAAGLAGGSSTTVSVVDIKRHLGDVVNITVKA
DPENTVAETNETNNEYTTTATVVSSGNYYTGGRFYTGNDLETGAYQEGNIAVKYSQGDSG
YKSGGGWYSTTVHWTNTDLPIPADVTVKEARLYQSYTWNNPGNPDFILRFNGNTVNQTAF
YGDGTDNFNGQGIFDVTPYFNKNSNTAIINASNPGVGIGGLYGAVLVVIYEDASEPYRMI
WLDEGCDSLYNADGISTDPYVAYAMFNNVTTENLVSAKMTTVLPSGADNSQSTILFNKQS
VPIKGSGSGDPAYKWYDVTDTLQNGTNELGVSCDGYMNLASAILEVTKETASEANFSANA
TSGHAPLTVKFTDISTGTPTSWAWNFGDGENSTEQNPTHIYTVEGTCNVTLTVSNSLGSD
SEVKTGYITVGSIVLAPIAEFSSDVTSGTAPLSVQFTDESTNIPTSWSWDFGDGKSSTEQ
NPSHTYETLGTYTVKLTASNYGGSNTTTKTDYISVTSDVPAPVANFTIDADSGQVPFTVN
FTDTSTGSVSSWNWDFGNGSTSTEQNPIHTYVTEGSYNVNLTATGPGGSNSATLPITVSA
PLTSPSYNGGIPLTTVRSGTVSGELWYDSYYAMETSAQKTFTLPSYTDIKWARLYVDVYD
GHMQNNYRGNVDIGIDADGDSTYEIQKQEIFDIAYSFPGEGGTGPVWLSDHMNRVTSDYL
MWYDLTDEINGQTVNVQATTTKIDSSFDGRVKAITLVVAYDDGDSDQVYYWVNQGHDTVN
PLDDTYTGSTAFGTSALASGWNSASLSAIYLASVDGIYAFQGTTLNSGTPQGSYYGDNTW
DVSSMLSAGQDSTFTYNKQEEKYYKIPLALMSVRNQSASPALPEAAFTADVTNGTAPLTV
NFTDQSTESPTSWLWDFGDGSTSTEKNPAHTYTADGNYSVKLTVTNASGSDDELKTDYIT
VTGVGASLPWQDPCESLDSWTYTNCGLFDTPVYEGNYSIGCDPGQLSGYNIYTSAERTIY
IPEGAKTLRFDALSLSTNYVYSNWVKVFLDDNEKLSLPVILNNKDWKHYEIDLTGIEPGE
HTFKIGAYMEYWWGNAGFYIDNIWVIADEEVLSTVTVAPAEAEIEAGDNLTFSAQASTQY
GERLTNTVFTWSSSDESVGTVDNDGIFTALSAGTVTVNATADGVTGSATVSVASSVPPAP
VAAFSANITSGEAPLTVQFTDESTGEGITSWAWDFENDGVVDSTEQNPSYIYNAAGNYTV
NLTVTNDAGSDDEIKTDYITVVMPPVPEADFSTNTTSGSAPLTVEFSDASTNSPTSWAWD
FGDNETSSEQNPEHTYSAAGDYTVNLTVTNAGGSDSEVKIGYITVSESSTPEPEPVAAFT
ADVTSGSAPLTVNFMDQSTGTPTSWFWDFGDGANSTDQNPVHTYSAAGNYTVNLTVENAA
GSDFELKSDYIKVSEASGSTVTLYFDPESSSVSENESIEINIVASNFPAGLSGYNLTIAI
DDPAVAEIVDIEYPSWALITENSTLPGTSIYMKTVDLEDSVKEGAADVVLATLTVSGKEK
GSANLSIGVKRLEEDSGDSIEPALLAGTIEVTLLSPLPDQEYTPRDLDGDGLYEDLTGNG
EFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVDMFAMI
Download sequence
Identical sequences Q8TSE7
gi|20089735|ref|NP_615810.1| 188937.MA0851 MvR163 NYSGXRC-10384x

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]