SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20089748|ref|NP_615823.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20089748|ref|NP_615823.1|
Domain Number 1 Region: 12-127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.74e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.07
Further Details:      
 
Domain Number 2 Region: 122-211
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000161
Family BphP N-terminal domain-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20089748|ref|NP_615823.1|
Sequence length 215
Comment hypothetical protein MA0864 [Methanosarcina acetivorans C2A]
Sequence
MKKFDINLESLINSSPIVIFLCKATENWPVELITENVRNFGHEVEEFTLRGVRYLDIVHP
EDKEKVKEEVARCSEKGCAELTQEYRIFTASGEVRWVEVKVLIRRDENGRVSHYQGTLCD
ATQRKKAEESVQKALKKKNELKNIIKSSPVFVFLCKPEERWPVEFVSENITKLEYTPEDF
TSGKIKFEDLIHPEDRKRIRSEVARFSREGYEECT
Download sequence
Identical sequences Q8TSD4
gi|20089748|ref|NP_615823.1| 188937.MA0864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]