SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20090156|ref|NP_616231.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20090156|ref|NP_616231.1|
Domain Number 1 Region: 21-316
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.8e-36
Family Pectin methylesterase 0.015
Further Details:      
 
Domain Number 2 Region: 622-708
Classification Level Classification E-value
Superfamily PKD domain 2.35e-24
Family PKD domain 0.00055
Further Details:      
 
Domain Number 3 Region: 330-433
Classification Level Classification E-value
Superfamily PKD domain 3.66e-24
Family PKD domain 0.00051
Further Details:      
 
Domain Number 4 Region: 433-523
Classification Level Classification E-value
Superfamily PKD domain 1.57e-23
Family PKD domain 0.00058
Further Details:      
 
Domain Number 5 Region: 527-622
Classification Level Classification E-value
Superfamily PKD domain 3.4e-18
Family PKD domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20090156|ref|NP_616231.1|
Sequence length 957
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MKSKTLFIVFTLIFLIGVPSTVSARDIIVGNGSGSYSTIQEALDGAEAGDVIIIKPGTYV
ENINVSKARLTIKPETNNVFIEPADSTKATIILSNVGITLTGFDIDGSVYVNNAMLGNSE
YYLNNMSQITNNVIENGGIGVGSESSGIIISGNKITGGTGIDVACCGDYNEITDNDILNC
STGIYVYDERYVPPISGNKINNCDVGIHVSGLYYDLENNEITNCGVGVIAGETGGASLIG
NKIMYCSDCGLKVLGSLETKGAYNNYFNNTVNVKFGDYEDTYTWNTSLTEGTNIFGGPYL
GGNYWAKPDGTGFSQTAVDANGDGIADSAYAISEKNYDYLPLTAKYNSASPASDFTANVT
SGTAPLVVLFTDTGSGVTPTSWLWDFGDGITSKHARTATHTFTNPGTYDVSLTVTNAAGS
STVNKSNYISVTPPQAPVADFFSPEVNDLRDFGESIPINETVSFIDNSTGSPMSWLWDFG
DGATSTARNPEHAYSARGGYTVNLTVTNSFGSNTTSKYGYVLVGVIDAPAIPAYFSSDVR
SGNAPLTVTFVDDLDAESPNYPIWREWDFGDGVVQTYMVDDNDSATPYAMHVYKKPGKYT
VTLYMDNRGGNSIITKYHYITVTDPNATVVNFSANVSSGPAPLVVLFTDTSTGPAPSSWL
WDFGDGINSKHAMNATHTFTEPGNYTVSLTVENSAGNNTVTKTDYIVVTDPVATSSSGGS
SHKSSGGSSGGGGGGSPEPAKNVEVKELSQVFITNGNEVKFDFTKNATCVVYVGFDAKRT
LGKTTTIVEQLKNSSSLVSELPEGEVYKSFNIWVGSGETSSSKNIENPVIGFKVEKAWIQ
DKGIDQASISLNRYKDEKWEQFPASLSGEDDKFLYFTAETPGFSSFAITGESKSTLGGSE
TGANLGSETRAVDETDEGNEGPEAEQEADPKESASLPGFEMIYGMAGLLAVFLYRRK
Download sequence
Identical sequences Q8TR89
188937.MA1292 gi|20090156|ref|NP_616231.1| WP_011021313.1.98848 MvR175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]