SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20090369|ref|NP_616444.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20090369|ref|NP_616444.1|
Domain Number 1 Region: 1957-2041
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000103
Family PKD domain 0.0015
Further Details:      
 
Domain Number 2 Region: 43-105,137-320
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000000000000306
Family YVTN repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 2061-2115
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000628
Family Type I dockerin domain 0.0086
Further Details:      
 
Weak hits

Sequence:  gi|20090369|ref|NP_616444.1|
Domain Number - Region: 1349-1422
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00108
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.083
Further Details:      
 
Domain Number - Region: 1084-1155
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.051
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20090369|ref|NP_616444.1|
Sequence length 2115
Comment hypothetical protein MA1510 [Methanosarcina acetivorans C2A]
Sequence
MYSLMRINRGIICLPLLAVFLVMITGTSIADDVNVEFVSHLGRDVSNVAVSGDYAYIGQG
NELVILDISDASNLSNLSEMGRVTTPSVINDITVKENYVYVADDSSGLVIVDISAPTSPT
LEGNYDTGYAYGVSVSGNCAYVADLHDGLVIVDVSTSTSPTLAGMGSYNSGDAWDVAVSG
KYAYVAFGAGLVIVDISAPTSPTLVGSYDTGYAYSVSVSDNYAYITDYTTGLFIVDVSTP
TSPTRVGSYDTEDIDGNTRGVAVSGNYAYVVDGDKGLVIVDISNPTSPTLASSYDTDGNA
KGIAVSGNYIYVADGDNGLVILRTDIQDQGLIDGSLVQVEGSSDVYLIKNGMKHLFTSPE
ALLWNEHSFDNIISVTSEILQNYPDGEDISISQPIIDKYHALGGEPIFGAPSGEGEKVGD
QDSAGTYCSYVNFENGAIECFKNGDHTGEAYAIFNPLYTKWASLGYGKSVLGYPIDNMSE
VQNSKFETPFRYQNFANGTENGSLEYNITSGNVFEIHGAIFAKWGSIGYADSVLGLVTTD
EYEAAPSPFGTVGRYSKFENGTIHWISDKEGENEEHPYRGEAFVTSGYLNEVHTNLGGTS
SDLGFPITDQREKDGHDYCVFEGGIIDWNDSTGTYDVKLGYEGLLFRAKDGIDVYLIENG
EKRYFTSPEALEWNGRSFDEVINVSSKTLDSIPSGPNISISQEIIDKYYALKGSTTFGQP
DGKGELNGEQDQDGNYCSYVNFENGSIECFKNGPHVGEAYAVLNPLFTKWRELGYGAGIL
GYPIGDMSEIRTSSKNTDYRYQLFANGTENGSLEYNITSGNVFEIHGAIFAKWGSIGYAD
SVLGLVTSDERDAVPSFKGTTGRVSDFENGHLHWHGSGDHYMNTNMTYGELDQLYTEIGG
TASELGFPITDQKEIDENGHCYCEFENGNIGWNEAEGKYKAYLTSEIYIELYFDRTYFDT
VNHMEQTQSHASEFEAGDTLKGYVNTNMIIDDHTVNTYVKMIMPDGTEKYAYRVDPFLPD
NPLYFSDEKQPLTEDPWYAETNTWNWDIYKMTGTEPEGTYTWEFWYEDVNTGEVLGKSTA
SYNFSKMTDLGEFDERCKYYVRVSNIDDLGEIWVNGHYIKNATYYGDSGWVDIHEPRGDN
FIEFKVTNAGGDWTYKFELMQNDSISETILWSDSCGVVGETGNGCNKNTDTGEVYDKVIR
FKNTAPVNVNVMYAYNESEGDIEKFDGYFEGITDYYNENSYGTISLNFQVADNGNWFQVP
HDIQWYNDNHVRHEISDGLHNFSYNNSAYEFAKDVIDGLDENVDYSDFDINLIIYAPSYT
WKWIDSPDSPLGIEYKHVPVYLGSAQAIPIDSVTSNNDGSFDCAENWIVFPISSDYDEEV
LAHEIGHQMGSLHHLINQDLYPSSGGGSNVSNWDVMHDNYACMSSFSKVNSGWLNFKEET
EFKDYEIYPLDSLHFGDEVIKFKPNEYSDDFYIFEYRRAIGHDSILNNDQNRVNEDNPNG
VIVIYTATNGSTLHTTTNSLTGKNETDTYTVHVLNSNLENNWNEPTFYNEVSSIEDLFYS
YDKEEIDIVLKFINFSVVDVPDGNSAKINVQLENEIGLKGVILQMTNTIFYNLLFPYPLN
YTVNPTLSLHAYTDDGNHVGMNYETGEYEVQIPGARTSGLQPNEREWIIVPEDVNVKYVV
DSYANAKYMYQNPDLTGDFIDSYDLIGFYFDENGNDYSGKVTEHIAPGTQNEHSVVYSQN
LDGTYSIEVSKQYDVSLLPPLTNADTLSFIKGDILPIKFTARNPDTGDLVFDDQVNVLIK
NSTGTVIESFNTTSGVQVNSDEGYYTVDFYTADHPELIIGEKYSVLVTFGDINGGTGSGI
AYFILTGSNSPSSITNLQSTNGTTWINWTWTNPTDPDFNRTEIYLNNIFQTNTSTEFFNA
TCLEPETEYTIGTHTVDTYGNVNETWVNLTATTKNAPIIVEAGPGQTVKKGTTVNFEGNF
TASGLHTYSFHWDFGDGTNTTGSLTPSHVYEDAGAYEVTLTVTGENGDTGNDTLNITVTN
ASVSVFPGYTNPPTDPDKDGLYEDINGNGRLGFNDLVAYFANLDWIEENVPLEFFDYNKN
GLIDFDDVVTLFDML
Download sequence
Identical sequences Q8TQN0
188937.MA1510 gi|20090369|ref|NP_616444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]