SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20090605|ref|NP_616680.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20090605|ref|NP_616680.1|
Domain Number 1 Region: 12-345
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.57e-39
Family Pectin methylesterase 0.059
Further Details:      
 
Domain Number 2 Region: 844-936
Classification Level Classification E-value
Superfamily PKD domain 3.14e-33
Family PKD domain 0.00024
Further Details:      
 
Domain Number 3 Region: 355-439
Classification Level Classification E-value
Superfamily PKD domain 1.83e-30
Family PKD domain 0.00029
Further Details:      
 
Weak hits

Sequence:  gi|20090605|ref|NP_616680.1|
Domain Number - Region: 1095-1146
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000412
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20090605|ref|NP_616680.1|
Sequence length 1149
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MNKRIFLILFAIICIVLTMPAEAKTWYVDDDGGADFTDIQTAVNSASSGDTIYVYAGDYL
GFNVNKPYITIIGEGADLVTVGPTSQIRLPDIGNATGTDLEGMKLMSDLYLSTYGPAPDC
TIKNCILVNSISTAFGRYYSASNLTFEGNLVNGSGSINMYGLSSKSKILNNHFTDLSNTY
SAIYFRQDANFCTFSNNVLENSTATNMLTVYNVPGCTITNNTFRNNTGVALRLYKNTVTN
TTITHNIFSRNGGGIKFDSAGDNNKIYLNDFIENTAQIILLGTAPTTTIWSSPDQIPYTF
NSTTYTGYMGNYWSDYNGTDNNNNGIGDDPYVLPDSLGADNYPLMQPFENYFGGSGPVAP
VSAFTASPISGDAPLTVNFTDESTGSPTTWEWDFGDGANSTEQSPVHTYSTEGTYSVNLT
VTNEDGSDSELKTDYITVTQAGQVATNDLTISGIVNTVPASAVFAREANPVKVLNVKNTG
DETLSNISIAVYASDVSSGTVPVDTTTIASLAGDATTTVTLIDPTIRDLEGGTVTYTAVV
DPDNLIAETDETNNNKSSSAKPLRYNGYKGKGIYWEGGSNITTMHTFDLQGNLLYSTQPD
SAYQPVGWESRTETWTASDLPVPDDSTIEKVLLYVAYNWDQTPGGYPWLNIDFNGYILDN
GNISTGNGTLYRDWSNFGAYADYEYGLCVYDVTDKFSSAGNSLVMTPVGENKNALYPSTL
VVVYGNDNETRKQIFINEECDELGLSASSYGTTPEEATAYAPFTGMSIDVEKVTNAMLYS
FAGSAGPDEGNLLFNGNIVATNAWQGSSNSGSPLAFDATNYINATGNEAGVQSTTSGGMD
ALQQILVIEYEESAPAAPVADFTATPTSGDAPLAVNFTDTSTGSPTSWFWDFGDGANSTE
QNPSHTYSAAGSYTVNLTVENDAGSDFELKSSYIEVSEASGSTVTLYFDPESSSVSENES
TEINLVASNFPAGLAGYNLTVALDDPAVAEIVDIEYPSWALITENSTLPGTSIYMKTVDL
EDSVKEGAADVVLATLTVSGKEKGSANLSIGVKRLEDDSGDSIEPALLAGTIEVTLLSPL
PGQEYAPRDLDGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFD
DVVDMFAMI
Download sequence
Identical sequences Q8TPZ9
188937.MA1753 WP_011021757.1.98848 gi|20090605|ref|NP_616680.1| MvR184 NYSGXRC-10384v

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]