SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20090607|ref|NP_616682.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20090607|ref|NP_616682.1|
Domain Number 1 Region: 12-290
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.4e-35
Family Pectin methylesterase 0.076
Further Details:      
 
Domain Number 2 Region: 893-975
Classification Level Classification E-value
Superfamily PKD domain 1.26e-33
Family PKD domain 0.00022
Further Details:      
 
Domain Number 3 Region: 272-385
Classification Level Classification E-value
Superfamily PKD domain 4.45e-28
Family PKD domain 0.00021
Further Details:      
 
Domain Number 4 Region: 389-474
Classification Level Classification E-value
Superfamily PKD domain 8.24e-26
Family PKD domain 0.00036
Further Details:      
 
Weak hits

Sequence:  gi|20090607|ref|NP_616682.1|
Domain Number - Region: 1134-1185
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000432
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20090607|ref|NP_616682.1|
Sequence length 1188
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MNKRIFIILFSLLCTVLITPAEAKTWYVDDDGGADFTTIQSAVNSASSGDTIYVYAGTYN
EFAVPIPYLTIKGEGPDLVTVNGIIDIPQTATYANATGTVLEGMKITTAPNIQSVTGTAS
DITIRDCVFDGLTSVNLHVNTIFENNIIINNTNKGLELKADNSIIVNNTIKNSKDSAIWF
NAANTTVKNNHIESNGYAFYFRDAGDENKIYLNTISNNSEITKIRGTLPSITYWNSTTPI
KYTYNGTTYTGYMGNYWSDYNGTDSDGDGIGDTSYTVPNDLGTDNHPLMQPFENYNVVGS
GPVIPVSSFTASPTSGYASLTVQFTDESTGSPTSWAWDFENDGIIDSTNQNPSFTYTSAG
NYTVNLTVANADGSDSEVKTDYIVVNEPLPEPPVADFTATPTSGDAPLMVNFTDASNGTV
SSYAWDFDNDGNVDNEEENPSYTYETVGTYTVNLTVANADGSDSEVKTNYITVTQAGQVA
TNDLSIAAVLISPSNVVFAREANTIVAYGITNSGTENLTNITVDVYASDVSGTVPVNTET
ISSLAGGGTTTIFITDPTIRNLQGSTVTYTAVIDPDNLIPETNEANNNKSRAVPVKYNGY
KGKGLYWEGGSNITTKHTFDLQGNLLYSTMPATAYKSVGAWGSGRTETWTASDLPVPSGS
TIEKVFLYFAYNWDQTAGGYPWLNLSFNGNIIENGNLSTGNGTLYRDWSNFGTYADYEYG
LCVYDVTDRFSSSGNSLVTNPYDGDNNLYGKVALYPSTLVVVYKNSNETRKQIFINEECD
ELGVSASSYGTTLEEATAYAPFTGMSIETGKVQNATLYSFAGSAGSDEGNLLFNGNIVAT
NAWQGDSKTSNAQVFDVKSYLNETGNEAGIQGTTSGGMDALQQILVVEYEKSAPAEPVAD
FTATPTSGDAPLAVNFTDTSTGSPTSWFWDFGDGANSTEQNPSHTYSAAGNYTVNLTVEN
AAGSDFELKTDYIEVSEASGSTVTLYFDPENSSVAENESTEINLVASLFPAGLSGYNLTV
AIDDPAVAEIVDIEYPSWALITQNSTLPDSSIYLKTIDLEDSVKEGAADVVLATLTVSGK
ESGSANLSIGVKRLEDDSGDSIEPALLAGTIEVTLLSPLPDQEYAPRDLDGDGLYEDLTG
NGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVDMFAMI
Download sequence
Identical sequences Q8TPZ7
188937.MA1756 WP_011021759.1.98848 MvR186 NYSGXRC-10384t gi|20090607|ref|NP_616682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]