SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20090617|ref|NP_616692.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20090617|ref|NP_616692.1|
Domain Number 1 Region: 878-970
Classification Level Classification E-value
Superfamily PKD domain 3.92e-32
Family PKD domain 0.00028
Further Details:      
 
Domain Number 2 Region: 1453-1534
Classification Level Classification E-value
Superfamily PKD domain 8.5e-31
Family PKD domain 0.00026
Further Details:      
 
Domain Number 3 Region: 1357-1447
Classification Level Classification E-value
Superfamily PKD domain 2.09e-28
Family PKD domain 0.00012
Further Details:      
 
Domain Number 4 Region: 384-473
Classification Level Classification E-value
Superfamily PKD domain 3.14e-27
Family PKD domain 0.00028
Further Details:      
 
Weak hits

Sequence:  gi|20090617|ref|NP_616692.1|
Domain Number - Region: 1693-1744
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00104
Family Type I dockerin domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20090617|ref|NP_616692.1|
Sequence length 1747
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MDFCYLLWWELIVHIALGFFLYFGTGGKVTDRKLIFVLLTLILCSGVGLTLFTDAAAADE
WVGGLPLTTVQTETVTGDLWFDATPAPNWGEQVVTKTFTLPEAAVAEPGRIAWARLYISA
YCGHMQSDYAFSITNSWDGDNDGVYEQVWPETGHGAFQYIIDPNTWETLGNDNSEFDGHG
TQEPYLMINDHENRVTSDYFMWYDVKDLIYGQTINVNVDTTGSYDGRIKVITLVVAYNDP
SSTTQTTYWVNEGHDVCSYFTEDNFGEAAVGNTSFGTTGLSEVTSATLTVDYMASNNGCY
GFPTADNNFEYTGGTPSVEGTFTNLQLDRDPDTQGAYSGIDSWNVTSSVTGSSDVTLGYA
RYFLGEGTAAFYKIPLAFLVVKSPIETSSQPPVADFTADVTSGDAPLEVQFTDASTGTVS
SYAWDFDNDGTVDSTQQNPMYTYSTEGTYSVNLTVTNEDGSDSELKTDYITVTQAGQVAT
NDLSISGIVNTVPASAVFARETNPVKVLNVQNTGTATLTNISIAVYASDVSSGTVPVNTT
TIASLAGDAKTTVTLIDPTIRDLEGGTVTYTAVIDPDNLIAETDETNNNKSSSAKPLRYN
GYKGKGIYWEGGSNITTMHTFDLQGNLLYSTQPDSAYQAVGWESRTETWTASDLPVPDGS
TIEKAFLYVAYNWDQTPGGYPWLNINFNGNTLDNGNISTGNGTLYRDWSNFGAYANYEYG
LCVYDVTDKFSSAGNSLVMTPVGENKNALYPSTLVVVYGNDNETRKQIFINEECDELGLS
ASSYGTTPEEATAYAPFTGISIDVEKVTNAMLYSFAGSAGPDEGNLLFNGNIVATNAWQG
SSNSGSPLAFDATNYINATGNEAGVQSTTSGGMDALQQILVIEYEESAPSAPVADFTATP
TSGDAPLAVNFTDTSTGSPTSWFWDFGDGANASEQNVSHTYTSAGSYNVTLTVSNKGGSD
EELKTDYVKVTEPSVSEPDLLVSALTLNAGESFANEENTVSAKVENSGTAAAGSFTVRFD
VNDISTNVSVDGLSAGANITLSITDPSIRAYGDSVEITATTDTENSIIESNETNNALSIT
KTVVYNGYKGKRWTDGDDINTRATFEGKYDIIYSSGDSVYTSSKWLSVTDTWTSSDLSIP
ADASVVSARLYQPYSYNKMGIDPSFTAVFNGATISTDATYKDIKGYGSYNFPYGLYVYNV
TDQFSTAGNTLVLTPEGSAGTTNDYALWGAYLIVVYSDQETTEKQIFINDEFDMLYSKSS
YSVTSDEATAYANLSGVDTEDIGSAEVVSILASAGDSGKSKFFFNGEEYPGFWADYHDDS
KIGFSVYNVTDGIASGANEARFQSYDAGTGGDNVYAMNAILVVEYSESAPMADFMANTTS
GTAPLSVQFTDLSENATGWYWNFGDGANSTEQNPEHTYSAAGNYTVNLTVTNTAGSDSEV
KTDYIMVSESSTPAEPIAMFTADVTGGTVPLTVNFTDQSAGSPTSWFWDFGDGANSTEQN
PSHTYTSAGNYTVNLTVENAAGSDFELKSDYIEVSEASGPTVTLYFDPENSSVSENESTE
ISIVASNFPAGFSGYNMTVTLDDPAVAEIVDIEYPSWALITENSSLPATSIYLKAVDGED
AVKEGAADVVLATLTVSGKEKGSANLSIGVDRLDDDSGNVIEPTFLTGKIEVTLLSPLPD
QEYAPRDLDGDGLYEDLTGNGEFSFVDVVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDV
VDMFAMI
Download sequence
Identical sequences Q8TPY7
MvR190 188937.MA1766 gi|20090617|ref|NP_616692.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]