SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20090700|ref|NP_616775.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20090700|ref|NP_616775.1|
Domain Number 1 Region: 103-416
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 2.2e-49
Family TM0189-like 0.0035
Further Details:      
 
Domain Number 2 Region: 40-94
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000109
Family Type I dockerin domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20090700|ref|NP_616775.1|
Sequence length 422
Comment iron(III) ABC transporter substrate-binding protein [Methanosarcina acetivorans C2A]
Sequence
MNSMKTKALAGSLFSLLLLTLLALPATASDSAAESDILLSVLGNANEDGAIDMKDVEYTE
SIILGSGNRTQFADATGDNSIDMLDVTKIELIKLGKAKELTLVDGVGRQVNVALPVENII
PTDYRTTETLLALGTGDMIVGVDRAFHERMSEFGLTELPEVAMHGQSVDYEMVLTLKPDI
VLLPLWQAENADEIAKNLPDTSVVVMGLASQKSIDSDLTTMGFVLGKEAEVNELLSWMQG
YEVLVEERTKDLKAEDMPAFYYEYMSGGEEKWWVITPDDPSAGQVAEGTGGLNIATGLAG
TSVEVDPEWVIEKNPDFMFADLMKGFDSGPGKTKEDMENLLGKVLSGRPGFEKVNAVKNN
HVYLVDRDIIGGPRWVIGHIFFTKCMHPELFEDIDPAEIHKEYLKKFHNLEVAGTWAYPL
PE
Download sequence
Identical sequences Q8TPQ6
188937.MA1850 gi|20090700|ref|NP_616775.1| WP_011021851.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]