SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20090948|ref|NP_617023.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|20090948|ref|NP_617023.1|
Domain Number - Region: 45-89
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0699
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20090948|ref|NP_617023.1|
Sequence length 428
Comment hypothetical protein MA2104 [Methanosarcina acetivorans C2A]
Sequence
MGKGNIAIDKSMIKTIVDGKIIIPLPKVLVENRYYPMFSIFSPTQCDSCGSKLHVNSHHT
RFIISRYGTISLNVTYWLCPTCKKHYHDRVIGVQGSANYSSEYYDTQINVRYDGRCSLHN
SRRIGETYTEGVINVCGRAPCPTSLWLYEQKLAKLSKQELLNQGVSFEETLYVDGNWIKN
GWKKKLEEFIGTKLTKKEWKKMRYKSVYVVATKEKVILDFEVTERLPTIEALMPLFIRIK
NRFPEDKIKKIVSDEDKAIIGAVKMVFPEVTHSFCVFHQLKNVSKRYYEEFSSVEEIPDN
DKITYNEISQLILSDTVISAVAHIQKIREFNSDLELSEASHKAISYAEEIFSKNVSFLKK
GFTPETDNTMEQIFSLICDIVDKVRSFKTDNGLTNFCYNLFTFFNKRCFSTGKWKGFSPL
MRARFQYG
Download sequence
Identical sequences Q8TH30
188937.MA0027 188937.MA1038 188937.MA1896 188937.MA2104 188937.MA2378 188937.MA2634 188937.MA3493 188937.MA3761 WP_011020086.1.98848 gi|20088926|ref|NP_615001.1| gi|20089910|ref|NP_615985.1| gi|20090746|ref|NP_616821.1| gi|20090948|ref|NP_617023.1| gi|20091210|ref|NP_617285.1| gi|20091457|ref|NP_617532.1| gi|20092303|ref|NP_618378.1| gi|20092559|ref|NP_618634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]