SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20091215|ref|NP_617290.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20091215|ref|NP_617290.1|
Domain Number 1 Region: 42-353
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.57e-48
Family Galacturonase 0.097
Further Details:      
 
Domain Number 2 Region: 507-594
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-16
Family Cadherin 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20091215|ref|NP_617290.1|
Sequence length 1000
Comment hypothetical protein MA2384 [Methanosarcina acetivorans C2A]
Sequence
MNLDETLLNRIKVIALLNLKLVRKLVIFIMVNCLVLSGIPAALCMSSAPVVYVTGDGSGD
FNCDGTDDHVQINQALKFVAENSAYTTVYLKGPFTYVIDDTLLIGSNTILEGDSSAKIKL
VNNANWESRKPMIKERSTGISGITIRGFTIDGNREGNTNVVSGKGYYNLIHLSSCQNIKV
YDMYLTNNHGDGLKTDKCTNVEFYDNEIYLLGHDGLYASGCSDVEAYGNTITCRTNSGLR
LYNTNKASFHDNVITSEGSGGAGIEIQKYNTPAMDDIEVYNNVIYKTALAGIWIFGSGSY
SASTANVHVHHNQIYDTGTKTSNSIIGGIVSNGFSGLIENNVIDGAYGAGIVQKTVYSPA
PSGSGFLLTVRNNILSNSRSSSGGGSGYGINNELSGTHSFVLQNNCYYGSAGGDSRNVQL
SASDIKVDPQFADRSSHDYHLKSIAGRWNGKSWITDSASSPCIDAGYIASDYSKEPQDNG
GRINIGTYGNTKYASKSGTTEVVTNQAPVLNSIQDATVEIGESLTFTVSASDAEEDSLSY
SASGLPTGATFDSESGIFAWTPAVGQEGTYSVTFVVSDGELTDSATAIINVSKQEDTSKQ
EDPSTITGEVYDNRLREASPDIVYQSSPFIDVGAMSIGSYRDIMWFDLSVYADYSEVNSA
TLSLYWYYPAGKARPEDTVIEIYRPADSWNPDYVSWNKKDKRVAWNNAGGDWYDRNGVLQ
GSTPYATITLEGSDLPDNRYYELDVTDLVNEYISSKYENTGFLIKARTENNNYIAFYSND
CGNENQKPKLTVTEEASVSPIDVQPIDVTVSGAKDNRLREASAENVYQSSAYVDVGALSG
VGRYRDMMQFDLSEYADYSEVNSATLFLYWYYPAGKARPEDTVIEIYRPADSWNPDYVSW
NKKDKRVAWNNAGGDWYDRNGVLQGSTPYATITLEGSDLPDNRYYELDVTDLVNEYISGK
YENTGFLIKARTENNNYIAFYSSEAGGENQRPKLNLQLKQ
Download sequence
Identical sequences Q8TNA9
MvR204 188937.MA2384 gi|20091215|ref|NP_617290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]