SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20091288|ref|NP_617363.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20091288|ref|NP_617363.1|
Domain Number 1 Region: 22-305
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.88e-47
Family Pectin methylesterase 0.036
Further Details:      
 
Domain Number 2 Region: 370-486
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.94e-19
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20091288|ref|NP_617363.1|
Sequence length 498
Comment cell surface glycoprotein (S-layer protein) [Methanosarcina acetivorans C2A]
Sequence
MKGSSIQIISIFFVFMLGPAVTQAGAAVIIVDDSGGGNCSSIQEAVDNAQDGDTILVSPG
VYQENIKVDKELTIISHSTLAEDRTNRILIIGTVPNNDVFYVNSNSVTIDGFYILGYQSG
TDGSEAGIHLEGVQDCSLSNNTLVFNGQGILLNDSQGNYLDSNLVNLGDCGIALGDSEDN
ILSNNIVVTNKQGISLHNSVNNTLVKNIADSNTIGVFLGMSHGNKLAYNHILTNEYGISG
QAAGHNTLVDNSLYLNGIGVYLNESSDNTLYRNEFINLLNAVDKGNNFWNSSSEGNFWND
HTGKDTDGNGIADTPYLINRATGSIDYMPEVNETLSSNNSENTTKRMSALIALLNKGYSI
NPRNPEKGTVVEITRLEQINTSLQEGPVFLRIGAEWCPLCRAMSSTVTELASEYGEKATI
MLIDADRNPDFKSYFGVGHIPDFSVIVGIENGEYVYMKSDGNVSKDIDQARLVGIMDKEV
LEKVLDLALLHERQEKSR
Download sequence
Identical sequences Q8TN36
gi|20091288|ref|NP_617363.1| WP_011022428.1.98848 MvR205 188937.MA2457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]