SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20091344|ref|NP_617419.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|20091344|ref|NP_617419.1|
Domain Number - Region: 80-125
Classification Level Classification E-value
Superfamily RING/U-box 0.0565
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20091344|ref|NP_617419.1|
Sequence length 181
Comment hypothetical protein MA2514 [Methanosarcina acetivorans C2A]
Sequence
MILNPESDVIETLAKSILLAARTAPKAKGVDDIITALVEKEDVEVLALAMEKLADEKGEG
FAFLKRDARNLRNAGAAVLIGVKASGAAGLNCGACGFKTCAKMLDRQKVEAEFKGPNCML
KYADLGIAVGAATAKAKDFCIDNRVMYSIGAAARASGLLDADVVFGIPLSVTGKNIFFDR
R
Download sequence
Identical sequences Q8TMY2
188937.MA2514 WP_011022484.1.98848 gi|20091344|ref|NP_617419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]