SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20091616|ref|NP_617691.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20091616|ref|NP_617691.1|
Domain Number 1 Region: 1548-1644
Classification Level Classification E-value
Superfamily PKD domain 2.88e-31
Family PKD domain 0.00022
Further Details:      
 
Domain Number 2 Region: 536-618
Classification Level Classification E-value
Superfamily PKD domain 1.96e-27
Family PKD domain 0.00024
Further Details:      
 
Domain Number 3 Region: 455-537
Classification Level Classification E-value
Superfamily PKD domain 2.88e-27
Family PKD domain 0.00047
Further Details:      
 
Domain Number 4 Region: 365-453
Classification Level Classification E-value
Superfamily PKD domain 2.75e-24
Family PKD domain 0.00044
Further Details:      
 
Domain Number 5 Region: 985-1089
Classification Level Classification E-value
Superfamily PKD domain 9.68e-24
Family PKD domain 0.00055
Further Details:      
 
Weak hits

Sequence:  gi|20091616|ref|NP_617691.1|
Domain Number - Region: 1803-1854
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00122
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20091616|ref|NP_617691.1|
Sequence length 1857
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MMNINSKHSIYILPVLLILLFTGTVSALPTIAHDTVQGEMYVSSTANWDSKYSTNNFDVP
NGTVIFARYYAGVWSGTISTTFNGYAPTSTSSYASDMGVTWVSYDVTEYVIPGCENTAIV
ASSSGDGRQYGSTLVVVLENESKPQIEYWIAEGLDWMHYGDYVGSEVDNSTTYFNGTVDL
ADVQSASLYSTHLTGYNYEDFNGNSLSDAAESVGGSYFNYIHWDNVKDSLVSENQVVNVG
RGDDAYCSVVLHCLSIIYEYEKTDLVPVNLTPNVVVPNTENTLTATIENQGDKNSTAFNT
SLLVDGTVVDTQTVTNLASKSSTNVDFHWTPDGTTTNSYTLTVNVDPENVVNEGNESNNT
LTMLVGTTTALTPVADFTATPTAGDAPLTVNFTDQSTNSPTSWAWDFNNDEITDSTLQNP
IYTYSTSGTYTVKLTVTNAGGSNSSTKADYITVNTPIMPVANFTATPTRGDAPLTVQFTD
TSTSTPSSWLWDFGDGTSSTEQNPIHNYTAGRKYTVKLTATNAAGSSIEEKADYITVIAT
PVADFKATPTTGDAPLTVNFTDLSSNSPDSWLWDFGDGKNSTNQNPSHIYSIPGNYTVKL
TVNGLGGSDEEVKTSYIVSVDNIAPSVTASPNGGLYDHELDVTLSVTDNVDTNPVIYYTT
DGSTPTTNSTLYTAPIHIDNRTILKFITIDNAGNQAVQTMIYNIDNVPLTSYLFFKEHTI
SGSVDGPLTDYQIKMNIHRDTGTDNSSDVYLNDYSLNWPNDIRFTDANNSILSYWTEESD
DNTSTVWVKVNSIPTSGTTIKLYYGNANSADMNDGTNTFVAFEDFSDDTRRTSVWTENQD
QGVSGYTNVHVFENGGYHIRQDSRSDRGAEIVMTNELSVPVWCNVFLEVISESGGRNPPW
TFTGIGYAASDWNFGYWGGVLGYDTSPGHTYKITWTNAQNTSNILLYENSELLYSRDRSL
STTNKPDIGVRTASQEMGEWYYRNFYARTYTANEPVQGEWQSETPLQSVIARFSATPLIG
IAPLTVQFTDQSVGNITGWAWDFDNDGTTDSTEQSPAYTYTNNGIYTVKLTVTGLEGGNN
TKVKTNYITSDNLAPVVTANPFGNVCQVDQSVTLNVSDNIDPLPVIYYTTDGTDPNTTSP
AYTGPISITNSTTLKFMAVDAAGNQAPIQTENYTIDKVAPVVTASPEGGLYGHELDVVLS
ATDEVDTDPTIYYTTDGSVPTTNSTLYTAPVHITDKTLLKSMGVDEAGNQAVQIRVYYVD
TLPLTSYLFFKEHTISGSVDGPLTDYQIKMNIHRGIGTDNGSDVYLNDYSLNWPNDIRFT
DANNSILSYWIEKSDDNTSVVWVKVNSIPTSGTTIKLYYGNANSTDMSDGTNTFMAFEDF
TDDTRRTSVWTENQYDSDSGYTNVHVFENGGYHIKQDSQSDRGAGIVMTEELSVPVWCSV
TLEDVSESGGRTPPWILTGVGYATSNWHLGYWGGVQGGYDTSPGHTYRLSWTNGQTTNNK
LLYENNMLLFSGNSSFSTTNKPDMGVRTASRETGEWYFRDFYARTYTANEPVQGEWGNDT
HNSATPVANFSATPTSGDSPLTVQFTDQSTGSPTSWVWDFGDGANSTEQNPSHTYSAAGN
YTVNLTVENAAGTDFELKSDYIEVSEASGSTVTLYFDPESFSVAENESTEINIVASNFPA
GLSGYNLTVAIDDPAVAEIVDIEYPSWALITQNSTLPGTSIYMKTVDLEDAVKADAADVV
LATLTVSGKEKGSANLSIGVKRLEEDSGDSIEPALLTGTIEVTLLSPLPDQEYTPRDLDG
DGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVDMFGMI
Download sequence
Identical sequences Q8TM75
gi|20091616|ref|NP_617691.1| MvR212 188937.MA2793 WP_011022746.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]