SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20091707|ref|NP_617782.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20091707|ref|NP_617782.1|
Domain Number 1 Region: 26-272
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.42e-46
Family Pectate transeliminase 0.017
Further Details:      
 
Domain Number 2 Region: 360-649
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.29e-25
Family Galacturonase 0.077
Further Details:      
 
Domain Number 3 Region: 252-343
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000023
Family Galacturonase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20091707|ref|NP_617782.1|
Sequence length 686
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MAWGIYIQRFIALFLALLVFMLSSGIGTATEIIVQPGESIQDAVNNTVPGDEVVVSPGSY
TDNLRITTGDLIIRSASGNPEDTTIIANSQSEDVFYVEANNVTITGFGINGAGTDRAGVY
LVRSGNCIIENNRLANDTLGIYLKQSNYNLILNNTAVDGKRAINIERSNYNRASGNTISN
QRFGIYLLVSEGNTLSDNTISMSADHGIVLESSSNTSLENNIVSSNGDYGIYLASSSNCN
LTGNTADSNIIYGIYLKDSSSNNLVNNTALNNSRGIFLLRTRESMLSGNLASNNGRGIQI
TSAGNNDVLENSVSDNFYSGISFLNSTNCNVSENILANNTIGIDLAFSSNSTVLNNTMQN
GGRGLNLEDSNYNTLLNNNAVKNRYGAYLLRSGWNVLSNNDVSESEDHGIVLENSSNYND
LTGNLASYNRAYGIYLGDSSNNNLNSNEASGNNRGVFLTKSNRNTLLNNTVLDNSEYAIL
LTYSSENNISENDASNSNRGIHLSTSSDNTISGNNIVSNGVSGLYMTSTSNNNTVFNNYL
NNNVNANIKPGSFGNVWNTTKTAGTNIAGGPYIGGNLWAKPDGTGFSQTATDADGDGIAD
GVYNIGTSGYTDYLPLVTASIPGQPTTPVDVTDNQTESLDNQTESLDNQTESLDNQTESM
DNQTESTDNQTEISTDNQTESMDDQM
Download sequence
Identical sequences Q8TLY7
gi|20091707|ref|NP_617782.1| MvR213 WP_011022835.1.98848 188937.MA2885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]