SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20091708|ref|NP_617783.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20091708|ref|NP_617783.1|
Domain Number 1 Region: 2-278
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.64e-35
Family Pectate lyase-like 0.08
Further Details:      
 
Domain Number 2 Region: 483-576
Classification Level Classification E-value
Superfamily PKD domain 8.11e-27
Family PKD domain 0.0000926
Further Details:      
 
Domain Number 3 Region: 587-667
Classification Level Classification E-value
Superfamily PKD domain 1.19e-19
Family PKD domain 0.00055
Further Details:      
 
Domain Number 4 Region: 294-459
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.95e-19
Family Galacturonase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20091708|ref|NP_617783.1|
Sequence length 903
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MDSADPGDEIIVAPGTYTENIFINKDDLEIRSSGEPEDTKIVADNSSTYVIKIQNVDHVT
IQGLTVSGGLHGIVLENSKDSILENNVVYSNLLFGIYLSNSNNTKLESNKMYNNTNGINL
VFSSGNLISDNTVSNDILGSSTHNIFLNNSHNNDLQRNTVSKGDYGIAMRYSDNNNLTSN
SASGNNRGIYLTLKSSTNTLSDNQVNSNLMSGIILDNAGSGNNLINNTVRLNNGNGIWLA
NSNNNYLSINNASQNSKGIYLQSSASENTLSGNIVNSNTGSGIMLENAGNNNKLIGNTVN
SNTHYGFYLVNSSNNFLLDNVVSSGEKGINVLSSSGITISNNTLSDTTKEGIALSLSNNN
NLSRNTASKNSFGIYLNSSDSNDISSNIITSCINFSIGMCAASNDNLIFDNYFNSKNNAR
IKNPSNTWYITKTAGTSIAGGPYIGGNFWGKPDGSGHSQIYGDTDGDGITDEDGVIKEFT
TENVIDRFPLVAVAPPVVPVANFSTNVSSGYAPLAVQFTDLSEDATGRSWDFGDGNNSSE
QNPIHSYSMVGSYTVNLTVSNPNGTDSKTAVITVLEEGGDEDNETEILPVANFTVDKTGG
YYPLTVLFTDTSQNATGRSWDINGDGVEDSNETSFSYTYTSRGTYTAKLTAINANGTDIK
TTTITVEKKSSGGSSGGGGGGGSPEASSNVEVKELSQVFITNDKAIKFNFAKNATCVVYV
GFDAKKTAGKTTTIAEQLKNQSTLVSGTPSDKVYKFFNIWVGNSGYATSKNIENPVIGFK
VEKAWVQDEKIDQSSIILNRYSNKTWEQLPASLSGEDNKYLYFTAETPGFSSFAITGKAS
ASQEETAAEIQSEDESENSEENTGDTGSEVEQETEQEEGMGMPGFEMLYGVAGLLTLFLY
KKK
Download sequence
Identical sequences Q8TLY6
MvR214 gi|20091708|ref|NP_617783.1| WP_011022836.1.98848 188937.MA2886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]