SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20091905|ref|NP_617980.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20091905|ref|NP_617980.1|
Domain Number 1 Region: 70-390
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.89e-44
Family Galacturonase 0.097
Further Details:      
 
Domain Number 2 Region: 338-501
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000204
Family Pectate lyase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20091905|ref|NP_617980.1|
Sequence length 936
Comment hypothetical protein MA3087 [Methanosarcina acetivorans C2A]
Sequence
MKETGFLPVFRSETSWNNLVPTNEFHYRYITKNQIILTPVRAMLKRKLGTLFLVTCLIIL
GVPAVLGSPSAPVVYVSGDGSGDFNCDGKDDHVQINQALKYVKDNSAYTTVYLKGPFTYV
IDSPLLMYSNTILEGDSNAVITIEDDNSWGKDIPLIKQASPSKTNPGKIIIRGFEIDGNY
EGNTDKPRGSSYHTLMWFYYDDVEVYNMYLHDSHNDGLKIKESNSVKFHDNRIYKLGHDG
FYAIECENIEYYNNTCRTKTNSACRLYNSNHAKIHDNIIYTEFESDAGGPGIQIQYTRKD
VAQPMNDIEVYNNIIYDTYGPGIWLIAYGKSYAKTEAANVHIHHNIFYGCGTNQNYNWVC
GIETSGFYDTLIENNVFDGNYNAAIMYMYPSAPQFSGLEPNGMSDDYTTIVRNNIIVNTL
KRKYSSEGTGKGVVNYYPETHKFILQNNCIYNNAGGAYKNADSDSDIYVDPLFVDQKNHD
YHLKSTSPAAGMGVYAGASTVTDIKNTVNETPVTETEENVSFTEENATGIIADNRLREAS
PYITYQEKAYIDIGGRPGVGRYRDLILFDLSKYDDAENITSATLSLYWYYPDGRARPEDA
IVEIYRPAAAWDPQSVTWNSRGDCVPWTYPGGDWFDKDGILQGDDPYATITLKGCSLPDN
RYYEINVTELVKEYASGKYENTGFLVKTRTEDADYIAFYSNEGGNESQRPRLNVTKKLAE
SPVENPALEVIITAAKGGSLNECHPKNIQNKQFIGVGAMSTGGRYRDIMWFNMSEYTGPA
EIDNATLSLYLFYPESSRPEEDTVIEIYRPASAWDPSYVSWNGKDRCTSWKNPGGDWYDK
NGILQGSTPYATFTLRASDLSDNSYFELNITDLVKEYVSGKHENTGFLIKTHNESNDYVA
FYNNDGGDGKQQLTLSICTNGTVNGTVNGTVNGTVK
Download sequence
Identical sequences Q8TLE9
188937.MA3087 WP_011023026.1.98848 gi|20091905|ref|NP_617980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]