SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20091951|ref|NP_618026.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20091951|ref|NP_618026.1|
Domain Number 1 Region: 23-257
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.33e-35
Family Pectin methylesterase 0.051
Further Details:      
 
Domain Number 2 Region: 279-374
Classification Level Classification E-value
Superfamily PKD domain 1.83e-23
Family PKD domain 0.00021
Further Details:      
 
Domain Number 3 Region: 551-632
Classification Level Classification E-value
Superfamily PKD domain 1.83e-22
Family PKD domain 0.0003
Further Details:      
 
Domain Number 4 Region: 379-460
Classification Level Classification E-value
Superfamily PKD domain 9.42e-20
Family PKD domain 0.00056
Further Details:      
 
Domain Number 5 Region: 635-717
Classification Level Classification E-value
Superfamily PKD domain 3.27e-19
Family PKD domain 0.00033
Further Details:      
 
Domain Number 6 Region: 463-546
Classification Level Classification E-value
Superfamily PKD domain 3.92e-19
Family PKD domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20091951|ref|NP_618026.1|
Sequence length 959
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MWKMKRELSSLFILILSLQVFSGSAAAAIIYVDSDGSGNYATVQAALDNAVDGDTIIVRP
GNYNEDLAVDVSVTLNGSSGYPTVGKIEVNRQSQISGLTITGGVRFEQAGMSCIIRNNKF
DECGVSIGNNYAYGNQTIIDNLFTDSPTGVFTYDSIYNKITGNTFQNCHTGIELTYGGGL
HVVKDNTFQDCDVGVRLIDDSATIYNNYFSSDINLELEDDGDARLNTTKTTGTNIIDGPY
IGGNFWGSPSGDGFSQIHLDTNGDGIAEEEYQVDEGVIDYLPLVTPRTEPEPVLPVANFQ
ANTTRGHAPLSVLFTDLSENADSWNWDFDNNGQPDSTVQNPIYVYEVPGAYTVNLTVSNA
NGTDTETAVITVLEEELPVLPVANFTLNKTSGYYPLTVLFTDTSQNATSRSWDVNGDGVE
DSNETSFAYIYNSKGTYEAKLTVSNANGTDTETAVITVLEEEIPILPVANFTLNKTSGYY
PLAVLFTDLSENATSRIWDVNGDGVEDSDETSFAYIYNSRGTYEAKLTVSNANGTDTETA
VITVLEEELPVLPVANFTLNKTSGYYPLTVLFTDLSENADSWSWDFDNNGQPDSTVQNPI
YVYEVPGAYTVNLTVSNANGTDTETAVITVLDEEIPILPVANFTLNKTSGYYPLTVLFTD
TSQNATSRSWDVNGDGVEDSNETSFAYIYNSRGTYEAKLTVSNANGTDTETATIDVVKKS
SSGSSGGGGGGGGSPEPAKNVKVKELAQVFITNGKAIKFDFKNNATCVVYVSFDAKKNAG
KTTTIVEELKGKSSLVSALPAGEVYKSFNVWVGNSGYATSKNIENPVICFKVEKAWMEDK
SVDQASITLNRYNDKKWEQLPAKISDEDDTYLYFASDVLGFSSFVITGTSEAVSENVIEN
GTSLETRALQDDGNESKGPETEDEQEGSTTFSDIPPVYGIIGILVLGLICVIIYLKLPK
Download sequence
Identical sequences Q8TLA5
188937.MA3133 gi|20091951|ref|NP_618026.1| WP_011023071.1.98848 MvR219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]