SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20092144|ref|NP_618219.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20092144|ref|NP_618219.1|
Domain Number 1 Region: 414-636
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.41e-52
Family DNA/RNA non-specific endonuclease 0.00067
Further Details:      
 
Domain Number 2 Region: 107-326
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.75e-31
Family Prokaryotic proteases 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20092144|ref|NP_618219.1|
Sequence length 654
Comment hypothetical protein MA3330 [Methanosarcina acetivorans C2A]
Sequence
MRSNIILVIYFNYFKLLCYDGGKDMLENARKEEQQRKASERYYSRQKAAEAEQPGERFRR
EIIRPLTEVRPIERRLIFLEPGDDLALERIIGKSDLVGISYLELGLLAARPVCRIQVVNP
FGRPEGYGTGFLVGPNLLLTNNHVLDTAELARKSFAEFEFEQDINGRRKTSKSFDLRPDE
VFVTDPDLDFTLVSVAPVATEGTELTDYGLLRLVEDTGKVRNGEYVSIIQHPEGGLKQCC
LRENEVVDLFDNWIHYLTDTQPGTSGSPVFNDQWLVVCLHHSGVPMKDAQGNILKTDGQP
YREGIDNPGTIAWVANEGVRISRIFQALESRSENEPMAAESLRRLRSQGTDPVGPAIITA
PETVPGTAMELGELPAEHYHLADGYNPDFLGYLHQLPLPKLADNLQSKVAKLKDGGEILN
YLHFSIVMNADRRLAFYTAANIDGKKLKKIKRDRDKWYFDPRLDQRYQAGPKLYKGNPLD
RGHLVRRLDPCWGPNARDAGEDTFHFTNCSPQHERLNQHDWLEVEDYILKTADNANVQIS
VFTGPVFREDDMIYRNEYLLPADFWKVVAFVNKNGKLSATAYLRTQKNYLESLEFFDDEF
KTWQVPVAQVEALTGLSFDLPTDADPMARAAAGKGLESQRVNIRRIRSAADIIL
Download sequence
Identical sequences Q8TKR8
188937.MA3330 gi|20092144|ref|NP_618219.1| WP_011023260.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]