SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20092498|ref|NP_618573.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20092498|ref|NP_618573.1|
Domain Number 1 Region: 1721-1803
Classification Level Classification E-value
Superfamily PKD domain 2.75e-31
Family PKD domain 0.00022
Further Details:      
 
Domain Number 2 Region: 1166-1258
Classification Level Classification E-value
Superfamily PKD domain 3.66e-29
Family PKD domain 0.00039
Further Details:      
 
Domain Number 3 Region: 738-819
Classification Level Classification E-value
Superfamily PKD domain 4.58e-29
Family PKD domain 0.00026
Further Details:      
 
Domain Number 4 Region: 649-735
Classification Level Classification E-value
Superfamily PKD domain 5.1e-28
Family PKD domain 0.00031
Further Details:      
 
Domain Number 5 Region: 974-1175
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.41e-27
Family Quinoprotein alcohol dehydrogenase-like 0.0039
Further Details:      
 
Domain Number 6 Region: 112-196
Classification Level Classification E-value
Superfamily PKD domain 3.92e-27
Family PKD domain 0.00046
Further Details:      
 
Domain Number 7 Region: 561-649
Classification Level Classification E-value
Superfamily PKD domain 4.32e-27
Family PKD domain 0.00035
Further Details:      
 
Domain Number 8 Region: 1637-1720
Classification Level Classification E-value
Superfamily PKD domain 3.92e-26
Family PKD domain 0.00016
Further Details:      
 
Domain Number 9 Region: 205-409
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.59e-24
Family Quinoprotein alcohol dehydrogenase-like 0.0073
Further Details:      
 
Domain Number 10 Region: 27-108
Classification Level Classification E-value
Superfamily PKD domain 1.57e-22
Family PKD domain 0.00017
Further Details:      
 
Domain Number 11 Region: 829-985
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.49e-21
Family Quinoprotein alcohol dehydrogenase-like 0.004
Further Details:      
 
Domain Number 12 Region: 330-558
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.31e-16
Family All0351-like 0.043
Further Details:      
 
Domain Number 13 Region: 1267-1356
Classification Level Classification E-value
Superfamily PKD domain 0.0000000602
Family PKD domain 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|20092498|ref|NP_618573.1|
Domain Number - Region: 1962-2013
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00163
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20092498|ref|NP_618573.1|
Sequence length 2016
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MKRIFLILCIAALMCMTGLASAAEETVGTVANFTTNTTSGSAPLTVQFTDISTNATSWAW
DFENDGTIDSTDQNPVHTYSTEGIYTVNFTVSNAGGNASEVKTGYISVSEPLPSAPVANF
SADITSGNAPLTVNFTDQSTGTVSSYSWDFENDGVVDSTEQTPSYIYTSAGTYTVNLTVT
NAAGSDSEVKINYITVEGTGTEGLADTAWPKYHYDLNNTGRSPYIGPQTGNVVWTFNAGG
SLQYNSPAIGADGTIYTGSCGTHEFYAINPNGTLKWTFRVGYTWQRFYGSPAIGTDGTIY
TGNRDGNLYALNPDGTLKWSYATANDIFKSPTIGPDGTIYIASCDGYLHAVNPDSTFKWK
VRWQNGNHEDVNLIGSPAIGPDGTIYIGSSSEAVFHAFNPDGTEKWNYTYTTGSTDYISF
YGSPAIGSDGTVYIGNRDSKLFALNPDGTLKWDFSIAQYDQILCAPAIGTDGTLYARSLN
GNFYAIYPNGTLKWSCSVGYSGHGSPVIGADGAVYVINSAGRICALNPDGTLKWDSNIGG
SYCSPAIGSDSTLYVCAGNALYAFRTEAPVANFSAEPTTGDIPLTVQFTDESVKDPISWL
WDFGDGDDTNATMQNPMHTYNAVGTYNVTLTATNIAGNGTESKTGYITVLEAVIPVANFS
AEPTTGDVPLTVRFTDESAKNPTSWLWDFGDGDDTNATMQNPVHTYNAAGTYTVTLKATN
FAGSNAELKTGYITVLEAVTPVANFSADMTSGDVPLTVQFTDESANNPTSWTWDFGDGST
SDQQNPSHRYVFAGNYTVTLTATNAGGSGTGTKTDYITVNAVERIKLADSAWPKFGYDLN
NTGQSPYAGPQSNNVVWTYTAGDNFYIGGSTIGPDGTIYICNADQNLYAFNPNGTLKWSY
NTEGYCYYCTPAIDSDGVIYVGNRNEKLDAINPNGTLKWTSPTGDYVYGSPAIGSDGIIY
VGCRDGNLYALFPDGTLMWTCAVGGRFNYVSPAIAADGTIYAGNYEDNKLYAINSNGIIK
WSYETGGRIYNSPAIAADGTVYVGSYDSNLYAINPDGTLKWNYTTGAQIYGAPSIAADGT
VYIGSYDHNLYAINPDGTLKWNYYADGEFRYSQPVIGVDGTVYIGDSSGKFYGISPGGTL
KWDYTTGGRVYGPASIGSDGTLYIGSYDKKLYAFRDAETPVADFSAVPISGGVPLTVRFT
DESAGYPTSWSWDFGDGENSTAQNPAHIYTASGTYNVTLTITNDAGSDTVEKIDYITVTS
GGSSGESAPIADFNVALYTDDCMPHGTAPITVSFTDNSTGNVSVYIWEYRNLYTGSEWTE
FGSGAQNPTDIEFSDVGTYDIRLTVSNSGGSSNRTIEHALTAGMSHDYLTTIQNGTVSGD
LYIDSRSPWTTTANYSYTLPASGDDIVWARVFVNDYSGSGSGNGALQLKTELDSDGDGTF
ETVLGVEECNIQSDTDQVVYPLNDHVSKVYSDYEAWYDVADLLNSTTPNIRVTASDIGVT
VGSDRGFDGRIKGVTLVVAYNDGDSDEVNYIVNHGNDWMTGSSSTTFDASTFASGWTEAE
IKSVSFSSTDASYTLDGNSIAASSLGSGGYYEFNSFNVTSALTPAASNTFGYTNQGVSFK
ICLAALTVGYGNESAGAPVADFTGTPTSGDAPLTVQFTDNSSGATEWSWDFGDGDDTNAT
EQNPVHTYAAEGNYSVKLTVTNAGGSDDELKTDYITVLEPSTPEPVAMFTADATSGTVPL
TVNFTDQSTGSPTSWFWDFGDGANSTEQNPVHTYSAEGNYTVNLTVENAAGTDFELKTDY
IEVTEASGSTVTLYFDPTSSSVAENESTEISVVASNFPAGLSGYNLTVAIDDPTIAEIID
IEYPSWALITQNSTLPATSIYMKTVDLEDAVKEGAADVVLATLTVSGKEKGSANLSIGVK
RLEEDSGDSIEPALLTGTIEVTLLSPLPDQEYTPRDLDGDGLYEDLTGNGEFSFVDIVAY
FHNMDWIEENMPVEYFDFNGNGRIDFDDVVDMFAMI
Download sequence
Identical sequences Q8TJS9
188937.MA3698 MvR135 NYSGXRC-10384m gi|20092498|ref|NP_618573.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]