SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20092499|ref|NP_618574.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20092499|ref|NP_618574.1|
Domain Number 1 Region: 79-328
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.1e-33
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 1357-1466
Classification Level Classification E-value
Superfamily PKD domain 5.49e-31
Family PKD domain 0.00016
Further Details:      
 
Domain Number 3 Region: 2218-2310
Classification Level Classification E-value
Superfamily PKD domain 2.09e-30
Family PKD domain 0.00026
Further Details:      
 
Domain Number 4 Region: 1876-1962
Classification Level Classification E-value
Superfamily PKD domain 7.46e-30
Family PKD domain 0.00031
Further Details:      
 
Domain Number 5 Region: 421-506
Classification Level Classification E-value
Superfamily PKD domain 1.83e-27
Family PKD domain 0.00036
Further Details:      
 
Domain Number 6 Region: 507-592
Classification Level Classification E-value
Superfamily PKD domain 4.45e-27
Family PKD domain 0.00039
Further Details:      
 
Domain Number 7 Region: 336-421
Classification Level Classification E-value
Superfamily PKD domain 6.15e-27
Family PKD domain 0.00057
Further Details:      
 
Domain Number 8 Region: 599-793
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 9.42e-26
Family Quinoprotein alcohol dehydrogenase-like 0.0047
Further Details:      
 
Domain Number 9 Region: 1034-1118
Classification Level Classification E-value
Superfamily PKD domain 1.14e-23
Family PKD domain 0.00031
Further Details:      
 
Domain Number 10 Region: 950-1029
Classification Level Classification E-value
Superfamily PKD domain 2.22e-23
Family PKD domain 0.00071
Further Details:      
 
Domain Number 11 Region: 720-948
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 2.29e-19
Family All0351-like 0.055
Further Details:      
 
Weak hits

Sequence:  gi|20092499|ref|NP_618574.1|
Domain Number - Region: 2469-2520
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00235
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20092499|ref|NP_618574.1|
Sequence length 2523
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MKDETNISGFIYSCTYVHECAFHPNRGRCRKAPPDRVVPMKRINLLNKATFLSSWIFWLG
LLVCLVLIVTPVAAAGPEWTANSSWNTPDVGEYSVPALADLDDDGDYDLMIGAKDGITYG
YENTGTPDSPVWTAKSEWNVPDVGSWSSPALADLDCDGDYDLMIGEIGGVTYGYENTGTS
DSPVWTAKSEWNTPDVSQNAAPSLADLDGDGDYDLMIGEGYGVTYGYENIGSSGSPEWAA
NSSWNIPSIGYYSSPALADLDGDYDYDLMMGGYDGVIYGYENTGSSDSPEWAANSSWNIP
SVGSRSLPALADLDCDGDYDLMIGESTGITYGYENTAPIIVPLAGFSASPTTGNVPLTVR
FTDESANNPASWLWEFGDDTNATMRNPVHTYNAAGTYNVTLTATNIAGNSTESKTGYITV
LEAVIPVANFSAEPTTGDVPLTVQFTDESANNPTSWLWDFGDGGDTNATMRNPVHTYNAA
GTYNVTLTATNIAGNSSESKTGYITTVLTAVIPVANFSAEPTTGDVPLTVQFTDESANDP
TSWLWEFGDDTNATMQSPVHTYNAAGTYNVTLTATNIAGNSSESKTGYITVTGEPIKLAD
SAWPKFGYDLNNTGQSPYAGPQSNNIVWTYTAGEYFTNGGPSIGPDGTIYINNVDKKLYA
FYPNGTLRWTNTTGARSYSTPAIDSDGTLYGGDYNGKLYAVNPDGTFKWEYTTGDKFMGS
PAIGSDGIIYAAGYNGNLFAFYSDGTLRWSYSTPGFDYSTPAIATDGTIYIGTYNSYLYA
INPDGTLKWTYQVGGEIYNSPAIAADGTIYVGCEDNNLYAINANGTLKWTYTTGAQIYGA
PAIGADGTIYVGDYSGILSAINPDGALKWTYEANYRFYSTPVIGSDGTVYIGDYSGTMND
NSGNIYAINRDGTLKWEYATGRIHSSASIGSDGTLYLGSYDNNLYAFRDVADFNAGPKMG
GAPLTVQFTDESTGSPTSWLWDFGDGDDTNSTVQNPVHVYTAPGIYNVTLTGADAYHSYS
TEKIGYINVTNDSSGVTAPIPSFTTDASSGRVPFTVQFTDTTTGNVSTWSWDFGDGETSD
EQNPVHTYVTEGTHTVTLTATGPGGTDTATSTMEVAAPLNTGSYDGGSPLLTVQEGTVSG
GLWHGSWPGFSGYGEQTFTLPPHTEIKWARLYADVYCGLMTDIKSFSMTIDIDGDGDGIY
ELQKHDAASIDYTNTPAWVNDHVVRVTSDYFMWYDLTDNITGNEVNIKATGGGSDGRIKH
VTLVVAYDDGDDDEIHYWVNQGHDTANTGSYTGSTVFGTSALSDPDAVNLSSIYCASVNG
AYTYNGESLSSGGPQGEYFGYNDWNVTEYFNSGEDSTVTYAPTGSYYKIQLALLTASGAG
SSGGDGPVADFTANVTSGGIPLTVSFTDESTGSPASWLWDFGDGNNSTEQNPVHTYSTEG
TYSVNLTVTNEDGSDSELKTDYITVTQAGQVATNDLSISGLVNTVPASAVFARETNPVKV
LNVQNTGTATLSNISIAVYASDVSSGTVPVDTTTIASLAGDAKTTVTLIDPTIRDLEGGT
VTYTAVVDPDNLIAETDETNNNKSSSAKPLRYNGYKGKGIYWEGGSNITTRHTFDLQGNL
LYSTQPDSAYQPVGWESRTETWTASDLPVPDGSTIEKAFLYVAYNWDQTPGGYPWLNINF
NGNALDNGNISTGNGTLYRDWSNFGAYADYEYGLCVYNVTDKFSSAGNSLVMTPVGENKN
ALYPSTLVVVYGNDNETRKQIFINEECDELAYSLTGYGTTPEEATAYAPFTGMFIDVEKV
QNAMLYSFAGSAGPDEGNLLFNGNIVATNAWQGSSNSGSPLVFDATNYINATGNEAGIQG
TTSGGMDALQQILVVEYTSSGTVPSTDFSADPTSGTAPLNVTFTDESAGAPISWSWDFGD
GNTSAQQNPSHIYTAPGTYTVNLTVTNNTGSSSVTKTDYISVAGGSTYTVGEDTVVIWNY
GSTTWTAPPGISEVEYLVVAGGGGGAGHYSNGGGGAGGFLNGTLAVTPGMGYAIMVGAGG
PGGDAGGSIGMNGSDSQFSTVIATGGGAGGNLGSAGLSGGSGGGAGSSTSATLPGGDGVS
GQGHAGGSNYPTGGGGELAGGGGGGASGTGGDGAYRLGGDGGDGITSSITGTEVVYACGG
GGGANLGPGGTGGSSAVNGGTGGGPQSGNVNGEAGLDSTGTGGGGAGWYGTGGDGGDGIV
IIRYHTSVPVAPVAGFLADPTSGTAPLTVQFTDNSTGSPTEWSWDFGDGATSNESSPMHT
YSAAGNYTVNLTVENAAGSDFELKSDYIKVSEASGSTVTLYFDPTSSSVSENESIEINLV
ASNFPAGLSGYNLTVALDGPAVAEIVDIEYPSWALITQNSTLPGSSIYMKTVDLEDSIKE
GAADVVLATLTVSGKEKGSANLSIGVKRLEEDSGDSIEPALLTGTIEVTLLSPLPDQEYT
PRDLDGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVDMF
AMI
Download sequence
Identical sequences Q8TJS8
MvR136 188937.MA3699 gi|20092499|ref|NP_618574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]