SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20092532|ref|NP_618607.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20092532|ref|NP_618607.1|
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000921
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20092532|ref|NP_618607.1|
Sequence length 76
Comment hypothetical protein MA3734 [Methanosarcina acetivorans C2A]
Sequence
MKCYECAREGKDTDAVGICIVCGRGVCKEHLIHEETPAWEGDYPIELKPDKEHIKRIVCV
PCHEALKENCLFNEVC
Download sequence
Identical sequences A0A0E3LBH4 A0A0E3P7L9 A0A0E3PT84 Q8TJP5
gi|20092532|ref|NP_618607.1| WP_011023639.1.11460 WP_011023639.1.43275 WP_011023639.1.98848 188937.MA3734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]