SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20093074|ref|NP_619149.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093074|ref|NP_619149.1|
Domain Number 1 Region: 22-338,397-416
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.1e-45
Family Quinoprotein alcohol dehydrogenase-like 0.0016
Further Details:      
 
Domain Number 2 Region: 1446-1530
Classification Level Classification E-value
Superfamily PKD domain 2.09e-26
Family PKD domain 0.00035
Further Details:      
 
Domain Number 3 Region: 1353-1441
Classification Level Classification E-value
Superfamily PKD domain 7.59e-24
Family PKD domain 0.00027
Further Details:      
 
Domain Number 4 Region: 1155-1337
Classification Level Classification E-value
Superfamily L domain-like 2.24e-22
Family Internalin LRR domain 0.055
Further Details:      
 
Domain Number 5 Region: 788-945
Classification Level Classification E-value
Superfamily L domain-like 1.22e-21
Family Internalin LRR domain 0.083
Further Details:      
 
Domain Number 6 Region: 418-500
Classification Level Classification E-value
Superfamily PKD domain 3.14e-20
Family PKD domain 0.00038
Further Details:      
 
Domain Number 7 Region: 946-1051
Classification Level Classification E-value
Superfamily PKD domain 1.01e-17
Family PKD domain 0.0007
Further Details:      
 
Domain Number 8 Region: 664-751
Classification Level Classification E-value
Superfamily PKD domain 1.83e-17
Family PKD domain 0.00068
Further Details:      
 
Domain Number 9 Region: 1089-1177
Classification Level Classification E-value
Superfamily L domain-like 0.00000000272
Family Ngr ectodomain-like 0.09
Further Details:      
 
Weak hits

Sequence:  gi|20093074|ref|NP_619149.1|
Domain Number - Region: 539-627
Classification Level Classification E-value
Superfamily L domain-like 0.000884
Family Ngr ectodomain-like 0.087
Further Details:      
 
Domain Number - Region: 1689-1740
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000981
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20093074|ref|NP_619149.1|
Sequence length 1743
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MNKHTLKIFLICVTLLLVAAAQPVLGSDWAQFQKDTYNSGITNEAGPISNNGSYAFAVLT
KSSGMSGIDTTPVVVDDVVYTVAQGVALAFNKTTGDQIWNHSVGGGFTLATPVVADGKLF
AGSNNGIIAALNISTGAEVWINSTGLGGEKAQVNTPIVYDAGNIYFGTWFSSGNPGSYYC
LNATDGSFVWERACTSSAGYYWAGACVVGDYLVYGGDDGHLVSVNKYTGMTMEDVSTGTI
FSSGTGNIRSSMSYDQSTGRLYFAAGSSCYYVGFDSGTGTFVKSVKGSGTMTGSSTSTPA
VYNDRAYVGCGGSLYCLDADTLETIWFYTVGAQVQSSPAISTYYDDGNGEIYIYFTTNDA
SCGMYCLKDIPGNTEPIVRFEFFPPGSMKQYSLQGAAISDGMVYYGNDAGYLFALADPEI
HFTANTTYGSAPLTVQFTDYSVGSTAWQWDFDNDGNVDSTERNPIYTYSAAGNYSVNLTI
NKSTGSVQELKTDYITVIEAKPLEDYLTYTSDSSSITITGYTGPAGDLVIPDEIDGLPVT
KIADRVFQGTPLTSVVIPDSVTNIGLYQFQNCEDLISIYTGGVPSISTNNIRNCPSLETI
TVGHRLSSITSYSIRDCPSLDAMVFEAEGDAPSASGNWNYNCPNLVVYYCENATSFTTPS
WAGKPCYPIGSPTADFSTNAISGSAPLTVQFTYSGVGANALSWYFDGDATVDSTARNPSY
TYDTPGTYSATLYVSNPWGSDSKLSTNYITVTEARADGWAYTSDGTSVTVTGYSGSDSDV
TIPGEIDGLPVTTIGASACKALTSLTSVTIPDSVTNIDASAFYGCTNLTSVTIPDSVTNI
GSSAFYGCTGLISVTIPDSVTNIDNSAFRGCTGLDSLTIGNGVTTIGSSAFYGCTGLTSV
TIPNSVTTIDTSAFYGCTNLTVMMFNGNAPTTVGSNWASGTNLVAYYSEGATNFTTPEWN
EVPCYPALTAATAEFTSNSVYGSAPLTVQFTYTGVGANAMAWDFGNDGTVDSTARNPGYT
YDVPGTYSIKLNVSNPWGSDSEVKTAYVTVAEQVDNFTYTSDGTSVTITGYSGPGGDVVI
PSTIGDLPVTAISGSVFKSNTNINSVTIPDSVTTIGSSAFYGCTGLTSVTIPNSVTTIGN
NAFNGCTGLTSVTIGNNVTKIDDRVFYGCTALISVVIPDSVTSIGDSAFYQCSNLASVTI
PDSVTTIDSYAFRDCTALTSVTIPDSVTNVESRLFYGCTGLTSVTIGIGLDEIPSYMFYG
CSALTSVTIPDNVTEIGINAFRKTALTSVTIGNNVTTIGSSAFRDCTALTSMVFTGDAPS
SVSSSWVDGCPDLVAYYYEDATGFTTPTWNGVACYPLTAAPVADFEADVTSGIGPMIVNF
TDQSTGIVSSYAWDFDSDGTVDSTEQNPSYTYISAGTFTVNLTVANANGTDSEVKTDYIT
VSEPSTPAEPVAAFTADVTSGTAPLTVNFTDQSSGTPTAWAWDFDNDGNVDSSEQNPGYT
YNAAGNYTVNLTVENAAGTDFELKSDYIEVSEASGSTVTLYFDPESSSVSENEFTEINIL
ASNFPAGLSGYNLTVAIDDPAVAEIVDIEYPTWALITQNSTLPGSSIYMKTVDLEDAVQE
GAANVVLATLTVSGKEKGSANLSIGVKRLEEDSGDSIEPALLAGTIEVTPLSPLPDQEYA
PKDLDGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVDMF
AMI
Download sequence
Identical sequences Q8TI71
gi|20093074|ref|NP_619149.1| 188937.MA4285 WP_011024166.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]