SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20093080|ref|NP_619155.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093080|ref|NP_619155.1|
Domain Number 1 Region: 412-741
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.85e-54
Family Quinoprotein alcohol dehydrogenase-like 0.00085
Further Details:      
 
Domain Number 2 Region: 1126-1365
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.96e-33
Family Quinoprotein alcohol dehydrogenase-like 0.0061
Further Details:      
 
Domain Number 3 Region: 894-1045
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.8e-27
Family Pectin methylesterase 0.013
Further Details:      
 
Domain Number 4 Region: 1320-1510
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.71e-27
Family Quinoprotein alcohol dehydrogenase-like 0.0026
Further Details:      
 
Domain Number 5 Region: 1601-1685
Classification Level Classification E-value
Superfamily PKD domain 2.22e-26
Family PKD domain 0.00035
Further Details:      
 
Domain Number 6 Region: 1514-1596
Classification Level Classification E-value
Superfamily PKD domain 2.35e-26
Family PKD domain 0.00035
Further Details:      
 
Domain Number 7 Region: 805-890
Classification Level Classification E-value
Superfamily PKD domain 4.32e-25
Family PKD domain 0.00033
Further Details:      
 
Domain Number 8 Region: 10-262
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.97e-20
Family Pectate transeliminase 0.093
Further Details:      
 
Domain Number 9 Region: 755-806
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000224
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 
Weak hits

Sequence:  gi|20093080|ref|NP_619155.1|
Domain Number - Region: 1844-1895
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00167
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20093080|ref|NP_619155.1|
Sequence length 1898
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MNLTKYLLLLFFAGFLLIMPASATTYDLYPDDPSGTAYDILQNQTQSGDTLFFHAGTYTR
NELGIYFCSFRYDDIVLEGENYSTVTFDLGDTFYMGTAGSITNNSTISNITFIPNADKKA
DLNLRYSSDCIIKNCEFSGKQTRPFIDFYNGGSNNTLVFNQIKDNADRGIRFYNGSAGVY
NGIADNRIYLNNFQNNTQDVYEKGMENMPNPVYWHSPEPLAYTYKGKTFTGYMGNYWDKY
TGVDANGDGIGDTPYDLGDCGQDDYPLMAPFENYTITESPSELFFEPSDTVMAGPGDTAE
IELLADELPEGFSTYVLNISVTDPEIARISGVSFPAWADTTSSTEIPAASVEIKASDLNQ
QVEAGASNVTLATIGLESLGYGTSNLTVSVESFKDDSENPVTLRTMEAGLKIPDSDWSQF
QKDSSNTGYGFSSAPTRDPEVLWQNLTSSEQEPCGSGGINAPPVVSGNTVFVTAGNASVW
AFDKDTGDLIWSKEMGGSLTQTATPALGDGKLFVPTLGGDLYALDPETGNELWNTHITDG
SLECPLTYYDHKLYIGDGLKGGNGTKYYYCYDDNGSFIWKHENTNSSGFIWSGSVVVGNY
LVYPVFEGKMVCLEKDTGTFVDEVDFSKSSDVSFALSDPGMFRSSVTYADGALYTSSERG
QETGYCFKVGFNPDTGQFLDTGWTASIGFSTSTPVVYNGRVYVGHGEHGETGSMFCLNDS
DGAIIWETPISGGIKSSPVISVEDGNPYIYFTEAIVDGSIYCLNPDGTLAWHYNPPEDSA
YTLQGAALSDEKVYYGTDNGYLYCIGQGEALPPTADFSSDKQTGSFPLTVSFKDMSFNAN
KFLWDFGDGNTSTEVNPVHTYTAAGSYTVTLTVENNHGEDTKVVEDYIYAVKVPTIWPVK
SGGSIQAAINSADSGDIIKVYPGEYHEVLTIDKNLTLKGIRDPVLNASGFTGSSGITISA
DDVEISGFEITGTEEMCFAINVNAKNALIEDNLIDDCAEGVWLQGTENTLRQNNISNCWD
FAAVLDAAGGNRIYQNTFLNNNGEYEGSSSHISGGSGSSFQSPEPVEYLWEGEKLTGYMG
NYYDDYTGNDSDGDGIGDTAYAAGAGTDQYPLVMPYSNYVEEQNESIPEDSWYQFHGKID
HLGYSESGPKTNRTEWISEDIDAISSSSSVIAEGKVFVICGGSGMEDSTDSTSRLAALDE
FTGELVWNATIPATVYGSWASPAYDNGMVFTATGPELGCYNAETGEKLWSFNNTVGSKGA
VNSGPAIADGMVVFSDWDGSHYYCLDEDTGYLLWSFEAEGYAQSVPAYEDGKFYLASWEY
GDLNQGHAYCVDAITGDPIWHINLEQNFCGSPAYRDGVLYLTTYNFYGTSDFLALDATDG
SVIWQQTIESTDSTPAFAYGNVYVCGGCEGFSNVQTYCFNASTGEKVWETPSLTGEEGGI
GGWTCSVAVADGLAYVGTEGGGYFSYNDLYALDAFTGEVVWHIPHAGSTPALSDGMLFSI
GADQKVYAFKDSLSSPIANFSADITSGNAPLTVNFTDQSTGTVSSYSWDFDNDGTVDSTE
KNPSYTYTSAGTYTANLTVTNAEGRDSEVKTDYITVSEPSTPAEPVAAFTADVTSGTAPL
TVNFTDQSSGTPTAWAWDFDNDGNVDSSEQNPGYTYNAAGNYTVNLTVENAAGTDFELKS
DYIEVSEASGSTVTLYFDPESSSVSENEFTEINIVASNFPAGLSGYNLTVAIDDPAVAEI
VDIEYPTWALITQNSTLPGSSIYMKTVDLEDAVQEGAANVVLATLTVSGKEKGSANLSIG
VKRLEEDSGDSIEPALLAGTIEVTLLSPLPDQEYAPKDLDGDGLYEDLTGNGEFSFVDIV
AYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVDMFGMI
Download sequence
Identical sequences Q8TI65
188937.MA4291 WP_011024172.1.98848 MvR242 gi|20093080|ref|NP_619155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]