SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20093094|ref|NP_619169.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093094|ref|NP_619169.1|
Domain Number 1 Region: 463-854
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.84e-55
Family Quinoprotein alcohol dehydrogenase-like 0.0017
Further Details:      
 
Domain Number 2 Region: 1267-1564
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.92e-46
Family Quinoprotein alcohol dehydrogenase-like 0.0012
Further Details:      
 
Domain Number 3 Region: 1652-1735
Classification Level Classification E-value
Superfamily PKD domain 3.4e-30
Family PKD domain 0.0003
Further Details:      
 
Domain Number 4 Region: 366-456
Classification Level Classification E-value
Superfamily PKD domain 4.97e-28
Family PKD domain 0.00035
Further Details:      
 
Domain Number 5 Region: 943-1155
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.32e-26
Family Pectin methylesterase 0.018
Further Details:      
 
Domain Number 6 Region: 1566-1648
Classification Level Classification E-value
Superfamily PKD domain 3.92e-26
Family PKD domain 0.00033
Further Details:      
 
Domain Number 7 Region: 28-352
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.54e-26
Family Pectate lyase-like 0.088
Further Details:      
 
Domain Number 8 Region: 856-939
Classification Level Classification E-value
Superfamily PKD domain 1.31e-23
Family PKD domain 0.00038
Further Details:      
 
Domain Number 9 Region: 1178-1284
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000051
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 
Weak hits

Sequence:  gi|20093094|ref|NP_619169.1|
Domain Number - Region: 1894-1945
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00255
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20093094|ref|NP_619169.1|
Sequence length 1948
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MTKNMTKNEIQNRIQNIAKHGFLLSIFLILLLVFAGSASAQTIEVNPGDDVISIIEDEAQ
AGDVIYFNPGTYNMGGSWNIYDKPVSLIGAGADEVTILGGKRVRLNYYDYAGASDIRVEN
ITFSTDIIIYGTDSYDSNLVIRNCVMNQYTDLDYLKNLEVSNNVFASASNQRNTIITVKQ
LDFSGNRMDKVYWNILWIDSGKITGNTFTNVTAHYAIEIEGGDDLTFSDNIISNCTENGG
GFLIDYKNDRNIITGNTFDSNSVGITVEVVNGETGTGNKIYHNNFINNTINIDDGSPAGS
VQYVSDTVNYNYKGKSYTSALGNYYDNYTGADADIDGIGDIPYTIGLGSDTAPLMGKVTV
SGENITITAASGSSVPIADFTAAPTYGNAPLKVNFTDTSTDDVSSYSWDFDNDGTVDSTE
QNPSHTYETAGTYSVNLTVANSAGSDTKTQTDYIKVIDTENLESEWPEFQKDSSNTGYGF
SYAPTRNPKLLWQNLTSPEQEPCGSGGINVPPVISGNTVFVTAGNASVWAFDKDTGNLLW
SKELGGDLTQTSTPTLGNGTLFVPTMEGDLYAFDPETGNELWNIHVTDGNLECPITYSDH
KLYIGDGLEGGTGTKYYYCYDDSGNLVWKHENTNSSGFIWSGSVVVGNYLVYPVFEGKMV
CLEKDTGTFVDEVDFSKSSDVSFALSDPGMFRSSVTYADGALYTSSERGQETGYCFKVGF
NPDTGQFLDTGWTASIGFSTSTPVVYNGRVYVGHGEHGETGSMFCLNDSDGSVIWETPVS
GGVKSSPVVSVENNKPYIYFTEAIVDGSIYCLNPDGSLAWHYNPADDDAYTLQGAALSGG
KVYYGTDNGYLYCIGQGEALPPEVDFSSDKQTGSFPLTVSFKDRSFNANKFLWDFGDGNT
STEVNPVHTYTSAGSYTVTLTVANNHGEDTKVVENYIYAVKTPTTWPVKSGESIQAAINS
ADSGDIIKVYPGEYHEVLTIDKALTLKGIRDPVLNASGFTGSSGITISADDVEINGFEIT
GTEEMCFAITVNAKNALIEDNLIDNCAEGVMFTGTGNTLRQNNISNCWDFAAVLDSTGDN
RIYQNTFINNNGRKMGGSSDHISGGSGSFFQSPEPVEYLWEGEKLTGYMGNYYDDYTGNN
SDGDGIGDVSYTADGGTDQYPLVMPYSYYVEEQENESVPEDSWYQFHGKVDHLGYSESGP
KTNRTEWVSEDIDAISSSSPVVAGGKVFVICGAGGMEESTDDIPQLVALDEFNGDIIWNV
SIPKAVYGSWASPAYDNGMVFTATGPELGCYDAETGEKIWCFNDTVGSQGAVNSGPAIAD
GMVIFSDWDGSHYYCLDEDTGYLLWSFEVVGDGQSVPAYADGKFYLTSWGYGSSYAGHAY
CVDAVTGEQVWHINNIEQNFCGSPAYKDGVLYLTTYNFYGDGDLLALDAADGSIIWQQTI
QRTDSTPAFAYGNVYVCGGCAGFSNVQTYCFNATTGTPVWSTPSKTGDNGGIGDWTCSVA
VADGLVYVGTAGDGYFGYANIYALDAFTGEVAWHTPHAGSTPAISDGMLFSIGGDQKVYA
FKDSLTSPVANFSADITSGNAPLTVNFTDESTGTVSSYSWDFDNDGTVDSTEQNPSNTYA
SAGNYTVNLTVTNAEGSDSDLKTDYITVSSTPVEPEPVAAFIADVTGGTAPLIVNFTDQS
TGSPTAWAWDFGDGANSTEQNPSHTYVSAGNYTVNLTVENAAGMDFELKTNYIEVSETSG
STVTLYFDPESSSVSENESTEINIVASNFPAGFSGYNLTVAIDDPAVAEIVNIEYPSWAL
ITENSTLPGTSIYMKTVDLEDSVKEGAADVVLATLTVSGKEKGSANLSIGVKRLEEDSGD
SIEPALLTGKIEVTLLSPLPDQEYAPKDLDGDGLYEDLTGNGEFSFVDIVAYFHNMDWIE
ENMPVEYFDFNGNGRIDFDDVVDMFAMI
Download sequence
Identical sequences Q8TI51
WP_011024186.1.98848 gi|20093094|ref|NP_619169.1| MvR244 188937.MA4305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]