SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20093096|ref|NP_619171.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093096|ref|NP_619171.1|
Domain Number 1 Region: 22-75
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000116
Family Type I dockerin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20093096|ref|NP_619171.1|
Sequence length 76
Comment EF hand family protein, partial [Methanosarcina acetivorans C2A]
Sequence
MTLLSPQPDQEYTPRDLDGEGFYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNG
NGRIDFDDVVRMFAMI
Download sequence
Identical sequences Q8TI49
188937.MA4307 WP_011024188.1.98848 gi|20093096|ref|NP_619171.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]