SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20093266|ref|NP_619341.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093266|ref|NP_619341.1|
Domain Number 1 Region: 27-97,381-607
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.66e-38
Family Pectin methylesterase 0.043
Further Details:      
 
Weak hits

Sequence:  gi|20093266|ref|NP_619341.1|
Domain Number - Region: 295-339
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00196
Family Pentapeptide repeats 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20093266|ref|NP_619341.1|
Sequence length 627
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MKRTLECIRNGWKVKPLIFVCCVLAFCFLLLVFTGSTSAKTVTVDARGWGDSRSIQAAVA
MAEEGDTVFVYAGEYNENVVVDKYLTLIAEDRDASSSLQKSDDSDSSEFGKIVVEADKIT
EEFGLDPMYETLMYISPSIKKASSDYLLLILDASGQIDLLEEIKNGPFSESEKLLLEESV
REIRRKYPIGFVRRDRVVYAYLISSERELDDDHEGNITERAGLENMAENVSTNISENIIE
NRSFAPSVKLYLTEDENRTLDRIQGVSTAYRDLFQRIREVDLKDTDFGQYEAIREVDLKD
TDFGQYEIIREVDLKDTGLREVDLKDTGLRKVDLKDTDFGQYEVDDEVIEYGNSVPGDDA
GEFVIFQTRPFDNVIIIPAKPDFPALEINADNVTVQGFVIKSDWGERPEVGLLLLGAGNC
TLLKNRVSGMEHGIFLRNCTDCVLESNLLDSNDEALVIENSNRSLFRANIMERGNNGIYL
KGSDENRLFENRAEDFSSGFRIEESMGNTIESNIAACNIQAGFYLLKAAENQLGNNSANN
NFQCGISLETSSGNTLVRNELWANTHGISLEDTSNENSVHDNQLFECEKGLLVSKDSTEN
RIYNNTICLRKIQDKSWIEDVLDQIFV
Download sequence
Identical sequences Q8THN3
WP_011024357.1.98848 gi|20093266|ref|NP_619341.1| 188937.MA4481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]