SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20093373|ref|NP_619448.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093373|ref|NP_619448.1|
Domain Number 1 Region: 1061-1144
Classification Level Classification E-value
Superfamily PKD domain 2.88e-33
Family PKD domain 0.00023
Further Details:      
 
Domain Number 2 Region: 364-447
Classification Level Classification E-value
Superfamily PKD domain 1.44e-30
Family PKD domain 0.00022
Further Details:      
 
Domain Number 3 Region: 945-1057
Classification Level Classification E-value
Superfamily PKD domain 3.92e-30
Family PKD domain 0.00023
Further Details:      
 
Domain Number 4 Region: 531-611
Classification Level Classification E-value
Superfamily PKD domain 8.5e-30
Family PKD domain 0.00025
Further Details:      
 
Domain Number 5 Region: 444-532
Classification Level Classification E-value
Superfamily PKD domain 1.7e-28
Family PKD domain 0.00028
Further Details:      
 
Domain Number 6 Region: 623-808
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.4e-23
Family Quinoprotein alcohol dehydrogenase-like 0.0068
Further Details:      
 
Domain Number 7 Region: 770-973
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.65e-21
Family Quinoprotein alcohol dehydrogenase-like 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|20093373|ref|NP_619448.1|
Domain Number - Region: 1303-1354
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000628
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20093373|ref|NP_619448.1|
Sequence length 1357
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MMNIRSKYAVYIFPLLLILFFVGTASALPTVAHDRVQGEMYVASTANWDSHYSTNSFDVP
NGTVVFARYYVGVWASGTPSSISATFNGHAFETNPSYYISGMGVTWIPFNVTDYVQPGET
NTATIDSSHWGDGRQYGSTLVVVLENENKPEVEYWIAEGLDWVIGYGSSTTYFNDTNIDL
DDVDSASLYSTILTGYSSESLNGESLSGAVDSVSGAYFNYIRWDNVKDSLTAENQTIKVV
GDGDYTSAVLHGLSITYKIPDLVPTSLTPSYVTPGTVNTMTATIENTDKDSPSFNVSLIA
DGTVVDTQDVSGIAAGGSTTVDLQWTPEGGKDSYSLTVVVDPDNSVVESEETNNELTVLV
GSASVEVPVANFTAVPTSGSIPLTVNFTDQSTNSPTSWFWDFGDGENSTSQNPSHTYTSV
GNHTVSLTVTNAEGSDSEVKTDYITVEVITPVAAFTADNTSGAAPFTVQFTDQSANLPAE
WFWDFGDGTNSTEQNPAHTYITAGKYTVKLTTANAAGNDSEEKTDYITAYIPPVANFTAT
PTSGGAPLTVTFTDTSTNMPTEWLWDFGDGVNSTDQNPIHTYTSAGNYTVSFTATNSGGS
DSELKTAYITVTAEAGKGGLADTAWPKFHYDLGNTGQSPYTGPQTANVVWTYTTTGEMRL
GQGAVIGSDGTMYIGDRSGTLYAINPNGTLKWGTSIGTKSFPTPAIASDGTIYAGGNDKI
VYAINPDGSIKWSYPVGTKSVISSPAIASDGTIYFATSTNLFALKPDGTLKWNSAVSYGG
YNYFSPAIGSDGTIYLGTYGGALSAINADGTLKWTYSIPAPNNYIYDTPAIASDGTIYFG
CNNANLYALNPDGTLKWTYSVGTSASQAIKSSPAIGSDGTIYFGSNNQYFYALYPDGTLK
WSSKAGSFGQTTPTIGSDGTIYIDNYGSKTLYAFNPDGTVKWSYADGNYNYASPAIASDG
TLYFGKGYTVYAFRDVAPVSNFTADPTSGTAPLTVNFTDQSTGSPTSWFWDFGDGANSTE
QNPVHTYSVAGNYTTNLTVTNSAGTDFEVKTDYITVLEPSTPEPEPVAAFTADVTSGSAP
LTVNFTDQSTGSPTSWLWDFGDGTNSTEQNPVHTYASAGSYTVNLTVENDAGSDFELKTD
YIEVSEISGSTVTLYFDPESSSVAENESTEISLVASNFPAGLSGYNLTVAIDDPAVAEIV
GIEYPTWALITENSTLPGTSIYMKTVDLEDSIKEEEGEVVLATLTVSGKEKGSANISIGV
KRLEDDSGDSIEPALLTGTIEVTILSLLPDQEYAPKDLDGDGLYEDLTGNGEFSFVDIVA
YFHNMDWIEENMPVEYFDFNGNGRIDFDDVVDMFAMI
Download sequence
Identical sequences Q8THC8
gi|20093373|ref|NP_619448.1| 188937.MA4589 MvR141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]