SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20093086|ref|NP_619161.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093086|ref|NP_619161.1|
Domain Number 1 Region: 22-349,408-428
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.84e-50
Family Quinoprotein alcohol dehydrogenase-like 0.0012
Further Details:      
 
Domain Number 2 Region: 523-791
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.34e-36
Family Quinoprotein alcohol dehydrogenase-like 0.004
Further Details:      
 
Domain Number 3 Region: 1523-1604
Classification Level Classification E-value
Superfamily PKD domain 4.84e-30
Family PKD domain 0.00029
Further Details:      
 
Domain Number 4 Region: 1433-1517
Classification Level Classification E-value
Superfamily PKD domain 1.31e-27
Family PKD domain 0.00039
Further Details:      
 
Domain Number 5 Region: 1000-1083
Classification Level Classification E-value
Superfamily PKD domain 1.83e-26
Family PKD domain 0.00046
Further Details:      
 
Domain Number 6 Region: 1341-1429
Classification Level Classification E-value
Superfamily PKD domain 4.19e-26
Family PKD domain 0.00021
Further Details:      
 
Domain Number 7 Region: 430-518
Classification Level Classification E-value
Superfamily PKD domain 7.59e-25
Family PKD domain 0.00031
Further Details:      
 
Domain Number 8 Region: 907-995
Classification Level Classification E-value
Superfamily PKD domain 2.09e-23
Family PKD domain 0.00026
Further Details:      
 
Domain Number 9 Region: 792-906
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.63e-19
Family Quinoprotein alcohol dehydrogenase-like 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|20093086|ref|NP_619161.1|
Domain Number - Region: 1763-1814
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00165
Family Type I dockerin domain 0.0095
Further Details:      
 
Domain Number - Region: 1618-1742
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0419
Family Cellulose-binding domain family III 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20093086|ref|NP_619161.1|
Sequence length 1817
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MNKHTLKIFLICLTLLLVTAAQPVLGSDWAQFQRDVYNTGVTADRAPITDPMNSTLSWEY
KLGANVDSAPIVAGDMMYALAGNNHIYAFNRTTGELVWEESTSGSLGFLIGNAAVGNGTV
FVPTSNGKIFAFDAQTGSPKWNKTVSSYTYNQIDTPITYSDGKIYFGEAMGQSRNYFCLD
ENGNQVWSRPATTKVSSQGPYYWAGATVIGDYLVYGDNDGHIVSVNKDTGTDIAEINVSE
EFGVDCKEIRSSILYVEDLGRVYFTSTGGYCFALGFNPADGTFKTSDKHSVNIAYTSTTT
PAYYNGRIYIGSGEIMKANGNGVYCLDADLTGVIWNYPVGGTGLVQSSPAISTYYDNGDG
EVYIYFTVNAKPIGGVYCLKDLPGSTSPELVWSYVESGKTDFSLPGVAISDGWVYYGTDN
KYIFGLTTPDLQVPEAPTADFSATPVSGEAPLTVSFTDLSMGDGITTWAWDFDSDGNVDS
SEQNPSYTYNDAGSYTVKLTVSNENGSDVLEIPEMITVKETVVSDDTWYQFHKDAQHSGY
SSSDAPDSADLAWIAEPLNNTYSLVPSSSVVIAEGMVFGLCNGPVDDYGNPLTSEGQLVA
FDENTGEEIWNVTVMAPEWGSWSCPAYDDGKVFASAGKNTYCVNASTGDIIWTFQNPSEL
ASCNGGPSIGDGKVFASDWDGGNYYCLDENTGELLWTFKIDGLYAQSTPAYKDDRVYLSG
WTTVNAVYCVNATTGELIWENEELSSNPCGSITVTEEGLYLSIYSFGTEDGFYKLDLTDG
HEIWGRPDIPPTDSTPAVVNGKVYLSAGTAGYSDLNTYCLNASDGKTIWVTDSSENIGDW
VCSPAVADGKVFTGGAAEGLFTGSSTLYAFDAETGAVIWSYKGCGGSPAVADDMVFSTGS
GKLYAFKEAEVLLPEAKFSSNVSSGEAPLTVGFTDESTGEGITAWEWDFDNDGNVDSIEQ
NPIHTYDNAGSYTVNLTVTSAEGSDSEVKDAYIVVSESLPESPVANFTATPTSGNAPLTV
NFTDASTGTVSSYAWDFDNDGTVDSTEQSPSHTYAAVGTYTVNLTVTGAAGSDSEVKVDL
VEVSKSLVNSYSTSMNNTNPGAPDPAIPGFVGPDGDGKCLGSGPNNVVNPAFLEWASVVV
DYSLANQSINPNFADPAKALGPVTGSNMDIVSLGDLEESQLLAGEQPGSVTFGFDVPIAN
GDGPDLALFENGFMSGSGIFAELAFVEVSTDNITFVRFPAVSLTPGLVGGYGTIDPTNVT
NLVGKHVNAYGNSWGTPFDLSCLENTTEVLNGSVDLNDINYVRVVDIPGNGFFKDSLGNP
IYDAWVTWGSGGLDLEAVGVINTAYLPVSAAEFSVNVTSGYAPLTVQFTDQSTYSPTSWA
WDFDNDGNVDSTEQNPSYTYATSGNYSVNLTVTNAGGSDSEVKEEYIIVSEPLPAPPITA
FTATPTSGDSPLTVNFTDESTGIPSSWAWDFDNDGSIDSTEQNPSYTYTSAGNYTVNLTV
ANAAGSDSEVKTDYIMVSESSTPAEPIAMFTADVTGGTVPLTVNFTDQSAGSPTSWFWDF
GDGANSTEQNPSHTYTSAGNYTVNLTVESEAGSDFELKSDYIEVSEASGPTVTLYFDPEN
SSVAENESTEISIIASNFPAGFSGYNMTVTLDDPAVAEIVDIEYPSWALITENSSLPATS
IYLKAVDGEDAVKEGAADVVLATLTVSGKEKGSANLSIGVDRLDDDSGNVIEPTFLTGKI
EVTLLSPLPGQEYAPRDLDGDGLYEDLTGNGEFSFVDVVAYFHNMDWIEENMPVEYFDFN
GNGRIDFDDVVDMFAMI
Download sequence
Identical sequences Q8TI59
188937.MA4297 gi|20093086|ref|NP_619161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]