SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20093331|ref|NP_619406.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093331|ref|NP_619406.1|
Domain Number 1 Region: 2-247
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.98e-124
Family Methyl-coenzyme M reductase gamma chain 0.00000000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20093331|ref|NP_619406.1|
Sequence length 248
Comment methyl coenzyme M reductase, subunit gamma [Methanosarcina acetivorans C2A]
Sequence
MAYEAQYYPGATSVGANRRKHMSGKLEKLREISDEDLTAVLGHRAPGSDYPSTHPPLAEM
GEPACSIREAVAATPGAAAGDRVRYVQFADSMYNAPATPYFRSYFAAINFRGVDPGTLSG
RQIVEARERDMEQCAKVQMETEMTDPALAGMRGATVHGHSVRLQEDGVMFDMLDRRRLEG
GVIIMDKDQVAIPLDRKVNLGKPMSSEEAAKRTTIYRVDNVAFRDDAEVIEWVHRVFDQR
TSYGFQPK
Download sequence
Identical sequences Q8THH0
188937.MA4547 WP_011024420.1.98848 gi|20093331|ref|NP_619406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]