SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20093413|ref|NP_619488.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093413|ref|NP_619488.1|
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Vng1086c-like 1.57e-26
Family Vng1086c-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20093413|ref|NP_619488.1|
Sequence length 92
Comment hypothetical protein MA4634 [Methanosarcina acetivorans C2A]
Sequence
MHKEELIQLHTYMAQMKRYFERHGVTHEFDDYKALSISPVHIHRSKADHKRAIFILGGEL
ATLMSRDDPIFEEASTHMRDSLNSVIKLIGNN
Download sequence
Identical sequences A0A0F8CKD1 A0A0F8CLY0 A0A0F8D9Y7 A0A0F8DFW4 A0A0F8E5G9 A0A0F8QF24 A0A0F8SA48 Q8TH88
gi|20093413|ref|NP_619488.1| WP_011024502.1.11460 WP_011024502.1.35842 WP_011024502.1.43275 WP_011024502.1.50979 WP_011024502.1.60556 WP_011024502.1.68146 WP_011024502.1.72848 WP_011024502.1.78801 WP_011024502.1.96639 WP_011024502.1.98848 188937.MA4634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]