SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000067800.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000067800.1
Domain Number 1 Region: 23-98,196-302
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.75e-23
Family Calponin-homology domain, CH-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 3707-3787
Classification Level Classification E-value
Superfamily RING/U-box 4.47e-19
Family ZZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 3594-3657,3692-3724
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000309
Family EF-hand modules in multidomain proteins 0.0032
Further Details:      
 
Domain Number 4 Region: 3312-3405
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000694
Family EF-hand modules in multidomain proteins 0.00068
Further Details:      
 
Domain Number 5 Region: 1071-1210
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000785
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 6 Region: 2976-3054,3090-3118
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000243
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 7 Region: 3549-3591
Classification Level Classification E-value
Superfamily EF-hand 0.00000036
Family EF-hand modules in multidomain proteins 0.042
Further Details:      
 
Domain Number 8 Region: 2712-2851
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000522
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 9 Region: 643-768
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000201
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 10 Region: 3281-3319
Classification Level Classification E-value
Superfamily WW domain 0.0000193
Family WW domain 0.002
Further Details:      
 
Weak hits

Sequence:  EmuJ_000067800.1
Domain Number - Region: 1276-1328
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000317
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number - Region: 455-505,535-555
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00187
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number - Region: 521-627
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00624
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000067800.1
Sequence length 4300
Sequence
MGDARQRRTLPSDLDFRDGKVLATQCRVFKRWVNSQLKQDVVGHEITEAVDIFRDSEALL
SLAQELANRKASTSNFRPSDGISTQENAISLIERLYGHDVATAIQLACDTYQRTDSDLSA
SSSSMRLTLGLDTLWILAVAAGAGTGPIEDVQEASGTVRGSVGSSTSTLIGQRSKRNSLS
SVLPEAEFCSTRTPLLDRWLTRQDERLLAWCQDATQSYEGVNICNYTTSWRDGLAFLAII
NQQRPELFSYRFRLEKTPMQNLGLAFHLITKEFAVARLLEPEDLLSNDAVDARSVAIYLI
ELRSAVEIDRRRRNKPAFEIRTTAMENQAQFGTPGEPDAGVTVTVVTTSSRSSSPTASEL
TFCSEEASELDEVSHLEDAQLNMAEFQHKAERSLAWMLSMEERLSDNCADLKAFNDDVKV
TGKAMLRDPMAVAEKADLIALEKSPIDDVKSLNETIVSRLMEARKRFNTHEDLTAHLTKH
EPMFRRCLRYGQRLANLAEHVQRISNTTPSSTTGDDSDTERQLIDHLQFVQPGEVKKMLS
LLQNRWTNLNRAAEAGNRFLAGCLLNRQEAVLSAVEIQLKMLEWERDRQATERFGTTVQE
LKSQLVANRRLENYLESGEKLAQHMQDIVILVPSETPDARDVDVEGRIATLATQWSRLVE
WVHTHYAQLQNALLHWRHFEEEADVLSEWLSQLQREAHEVEERKTREMEQRMLKMEGMTG
SNAAETEDEVTQQARLVSEAVSEAVSACLSRYETRWAQLLASLDRRASAVREACGDSIEI
QHAVETRVDALVSRWSQLTEPQLDLEENSLTITSRFVIPAMQQPDEAPLREGQPASDGAK
RPADGAPSTAPEKRVSLESGRLALMPTGYRAEFESRAEKLLNWLDSRIESLELVTLKAYD
EGQEQRATTEPRTSQPSKSPSEVIARIDKELPDAKENRIIVNSLGERYRRDLSQAGENVD
ELDQLFDDIEERWGLLDQFYKKATAQTVASKAATSDETASQKFPSPSPPPLSERSPHNIC
RSVESFRQWLTSAKSEATCPINCKDGNNLDDLISNFTRVVQMQPRTAVVEHFLATLEKQE
AQELTEEWYQVSNLISERVPVLQNLCENHDLFINQIERFEKLMGDMFDYLDSVAQATNVQ
PPAIEAQLGESIEALRDMEKMQPTLGHLDDIVEELRSFFSEPYIKKLNERLGELKRTWNR
VKELTNENILFLRGKLESAIVSKKAKIEVEEEKSTEDQASGSVASLHSAVQELPITATSG
ATRNQQPDTVMVRMLDMDELQKWISEAKHRLAKYATIKNHDEMEGFASVLKEFEKELASK
RPMIAAIRNGEVTDATGKPVSEKTALLFSGHFADLESEYAAGQERLKSATYHFNDFKSLM
SYEKHWLERVDSTIRKSKQKVFVDVGDICDDIMAFENLKSEHSEDDFARLKRIVELLSSE
RIMSQQLSAEFEAYAIGVTNALKELIQRLEELKKLKERTEEIQIRLDDYESWLNEISKAV
QQRMGDSETADSSRGEFLEWCTHIAVMDGVVSNVKRDLAKDLESYSMEARVPDSLVERIN
SIQVEASNLKRHLLLFTYPSDVRNSIQRCREITREHDVAAINLEIVSLISEHIAGLIMKS
VELIDRIQNGQKLIDQLQDKVSSVTPPPELRNANTELIEELRDLHEKNAKILDHVKRFEE
GVEKLQPFADRYSQIVDPLEQVMMNVEEVTDYLETADTQNSHIDMLQRVLGELSEVLGRE
EREPPSTKRSIPDEDKSTLQKLEELLVQIEAKITPTEGLNSTIADVRRVIDKAFAARNAF
RAQVNGLVSESNESSATEVTEIRISPQQPATCLESAQKPPARVDVSEAKNGAPEQLLSSL
YTRSNQLTSEMVAFFEDLATFNKFCVNLGQSARSQRDKESVEPLQTTIAKSRKKIEVYLN
FYEQYFRLQSQYLESRLKDILKAAEELSQEDKKIVLKVQKLWSDSRSNLSWELEQFRQLA
ELLKTADTALSKYEKLPTNSDRQACLTYITQLEDTYNWNLTQDRVRLEEGEHAEIARRLA
ASNRSTDLLAKLIPFRECLQQFVTQLNEIQDELHSCQSIPTHELSSQIQSLDQYFILAQE
AASKATNSLINCKTGQPPVSVENEGENELLATTLWLDAVLETQKGRLNAYCNEFHLCRPY
WQDYANLWQSFMNEAIRQKHQIEMLQLDRPPKEDQGSAEVSVGSARDYAVNLCSSVLTLQ
RLGNRIVWKAQSGEIGSGLDADLYLQPVFDKHCFRRPLRVESTLQDDITFVNETFDTLVE
DLRRLSKKYSIESFLRPNLRIDATGIDDYQAPSKSDSSSDSEGLQETTFPNTQNQKCEDT
GITDFEACLNRLKEELSWLQENALYIPIIDTPSNYISKLDGQFWLSPETSGPIRMSSKWV
KKKSQELAKLDAILKTHERRSAQLCAISEKVSSSLGDMEAQRQLHEASDELHACMDAARG
MIDRRRTRLCDWLSTCTAIEAAMLMDSDGEEVGKEKEQVLPRWIMTIRERLEKSLPNLDS
PLCKKELEQLRSEFSPTGNGTGQTLKAVEEAFENYQSDARLSLQSTHRNCVTPQLDAGVV
QGIEKSLSEWKSVCRLLRIDQAGQITPQASYVHQASMSSLDTNLETSVQKLAFWLDTVTS
YLNSTVACLGGDFNQDAVIAHIKNRVGDRSAYTVRSLYPAVIQIQLQQYAIELDARKPQL
DKLAIETERLDEELRNMDNTSTSQLSAMVEEVRQCWNATSAHVKARLEELEKMMTATEEL
KTLERELDRWLARAETDLANALSNTQDVVERKRIIQEIIDRLPSGETKFTTHQNKCEAIL
AKYSKEDTQKFRADQEAIQMRWSQLVSRLRESLEGTPQPDSDLIEIPIASRARAPETDLQ
KIVRLRTVTSQQPGTDIPNGRFLQPESRSMESSMIENCRSGVNNQGPTCSTLGRHSFDQK
PPLLGESYRTHQLSRSADIRSRPYDASRPSPRMSLENWPLFLAQLRQMNDWLAHQDANFH
QLKGTVGGDSESVSQLINSFSVLEEELRHQRFQVEDLLDRGQMFRRDQLAEGRYGFSTES
EGDSDGSEFDPGKSDVDESVMSTKRIVRRIRRHLVYLDKHWAELNRSMLAYRQQLDRAFQ
KLTVFERVLDDAERELEAAQKVLMAQDPSYPMDERTLQVIGDTFASVTHAIAGLDGQALC
LSDDGTIISHVLISRLDGLKIGLERLRSEANEGMNRFPSGNGAGSSALPTVVPVFQQALR
SPPQHFLNPNQLESSVSVNGGDAPIPRPKSPSECWLQAFQTVSYPWERCLLPCGNQVPYY
KNHATQETQWDHPLMIELLQRMDECNTIRFLAYRTAAKIRQLQLKLFFDQIPLNVATETF
ARHGLSSPLCSEGCDGRVMDVAQMVNCLTTLYCRVWDTLANQPDVVKTIDANAAVVRSGL
STQQTPTKSCTSESTLAGTIGQQTSMTENASLLESRSRSKKTPTHRSAINCMSSVLCATS
NKHSRGDESKSEKGSDGPRQRPATPSVENRPTKESERVSLGEMPPSGMQPSSSYSRVEKL
QTRLHLPDGREFALPTCVDLALNLLLNAFDGTRSGTIRVLSFKVTIFLLVNATLDEKYQY
LFSLVADRDNKINDSRLWLLVYEILQLPRQLGETSSSNCANNNLDPNILMCFKKNLKTKG
GHEHRSSSTIVSAPSLDSQISADSRPDDGELLPSVGLDRFYEWLKLEPPIVAWLPALHRL
IAGEKLIHQVRCAVCQACPIKGLRYRCLRCLNFDLCQNCFLIGRVEKSHKITHPIQEYTS
TLQRSDSLRDFSRVVRNRFRSKEKFRQSSSNAEDSSKSAATPTTPKAVGRATPTLYDRPP
RAVPIRQNSTDQQNATSSPAIWQTNRPASLGETRKHVLYSTPSVGGVDSSMPRLNAKPRR
GGSMDQEHELIAQYSHSLRRQNSLTPTGAMMPGGQSLLYYGPQDSVHSLGPPWLYSSATY
DRSRPPEPRFFTMRPNQLRGSGGFRANSQPPPHPGPGIYATGPPASAQAKWYRNPSGWEG
PMVAGSAGSLDKVLMNLEEENRFLRAEYDRLRMQSPAQNLRPLRSPSLQYPLSQMGLYQD
NMYHSAYGNPHFPPNSQLNPQLGYGQPISLLGRSQTERIYPSNNGVFYGGSLGRGSGAAA
YSAFLRSTGSGRVTFDSANQRYQSKPSPVTTSQQLAVTPTQESELAQETRLLRQHKTRLE
SRMQLLEDHNKVLEDQLNRLRQYLNIPPPPHAPPPPTSTNPTSRSVSHSVPGQTYTHENG
SIDQQTGSGYTGTQYLSSSDRPSPPSALVAPVNSVGFNQG
Download sequence
Identical sequences A0A087VXD5
EmuJ_000067800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]