SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000083600.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000083600.1
Domain Number 1 Region: 801-866
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.87e-16
Family SAM (sterile alpha motif) domain 0.0026
Further Details:      
 
Domain Number 2 Region: 28-180
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000123
Family Ankyrin repeat 0.0036
Further Details:      
 
Domain Number 3 Region: 394-482
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000171
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 4 Region: 726-793
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000236
Family SAM (sterile alpha motif) domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000083600.1
Sequence length 1101
Sequence
MRDSDDIYHLITQNRFAKALKRILKYARKDSLSEVSSLCSYSQWCEIIHNCIASSSQSAG
TATTRQSAHSCLKSLLQLQFSEQSTVRDLQSFINHAASIGNLEAVRVLLTPARGQWSPAI
LDDIKATALHAAARHGLMEMIQWLVEEEDADVLAATTTGQTALDFAVEGKHRGVIRYLLP
RVINSQLQPNGGEADTPRIRRTRSVSLADARLPQSQTQAFTKLSDPLRRRSAHFNQQLTC
REHTIYSNVCEAAASRPLIASNQLPSNSPINSAVALRTKPPTGSLERNSLPPICPNRRIL
PPRFGHPTLPFAYHSQCSMVRMPTGLATENLTSTQHQAMFSCLGKGNPGVEGDSSSAGRR
HTMGGSASVTGRSKNLAQSPFSQISPARHTQTIPSPWAPQAGTHSEVVKARATASFHGAT
CRSQSLCFNEGDIIGVFADSMTSKEDSAWWRGFRFANGPSGDIGMFPSSHVTLLPRQPPP
PPATQTGKQKKKSDFSAQTDVESSCSSSTEDDGDEEAEGGGSLLKKDATTVASDNEEAPH
VNEAKALCELETLTNAVLPVPLRSSAAGRQSSTSSSPSSTTMTASTPTSGHMNILMDSSN
RNSATSLDSGRGSAYATSSEGSKMISTSTCATFPHPHQHLQQVCPTQPLNMIPRVPPSCL
HRMTSVTSASATAATSSHPRGGYRAASVQPCASSTCSSASSASSASSGESSCSSCAAAVS
SVSSGTSSCDRSPVELLVNWLLSAGFSDYTPCLVAAGYDLSTLRRATPEDLNACGVTHPR
DRQQLRARLSRLQLPENLPDYIPSCVFEWLSILNLTSYWPAFQTQGLTTFEKVAVLTWED
LEEIGIMKLGHQKKLVLAIERIRRALSKRNEDQSVGTDSLTRIRQSQQQQHLLSSPSHPA
AQPLSIAEEQEATMTGNLADLTPPPPPGFQDPPHVVRKGSLDFSPPCIINPGSPEPRRMS
HHRHHFSTSFLTDVGRLGSNAISSVGDPGGEGSTKSDPLPRVGTCEGEGEAEAEGGVTSK
GKNSKGHQRGAQQGHAESFLSVRQRHRNAAAAAITIPVSVANQMIPPPTSGSAMDKDLQD
MQDIRSMLDKLSEHLVPRGSP
Download sequence
Identical sequences A0A087VXR6
EmuJ_000083600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]