SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000099700.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000099700.1
Domain Number 1 Region: 39-171
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000107
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 
Domain Number 2 Region: 481-536
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000214
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000099700.1
Sequence length 540
Sequence
MSIHSSATSLPRSAAVPRAASHDHHGGGTGGNVCGRIYWQHEVEHLSTLVTPASRPPPDP
ESSLKRLHQLADQKQLTITPVNLLLREQKAKRELLVTNIENGDICECIPLEDIITPIYKE
SNDQTDAFNNLLMFNVNASIHSKGGPPQHEMHIFQCISTSAHDIVGALVDAQEQELVNSH
LEPYAEVEEPHRATRNKFSENGNEDLTAQQLKEKALIDGEILLLNMCFDDIESYVGHIYK
LQRARWQNPTRGGPSDDNVSVSGADFKGKEKKKRRFIFKKRSRSPKNKDKNDMPRVTSNT
SLASEVEIPISDDELIDLFEKIKFSVILLSRLQGYVTEPNPPLLTHKLFSMMKQPIDFIR
DPVTGVPEMARKVISPLFPESAIRLIQNSLIEPELSLWRELGNGWCLPKEQWQAAVPTYI
PQFKCGFKPQPEQYHHTLFDVPPPKKSTANGGMHSSFSRSKLASGPEVRSHVEYLQYLRS
KKAKIARVMRDFLAESDQEISLKAGEYVEVLNDSLNWKHLRNRRGSEGYAPYTILDYNVA
Download sequence
Identical sequences A0A087VYN4
EmuJ_000099700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]