SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000128200.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000128200.1
Domain Number 1 Region: 40-99
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000971
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000128200.1
Sequence length 437
Sequence
MKKRMGGKKKSDSHARRTPQPSKPEIEEFFESVHERMKSLAIAQKSYRARNDKELSVQPG
EFFEVLDDVGSWWCLRAPSGRTGHVPKTHLEIIPNPAKEAERFNDQPIDPIVVKVPVIVK
ASVQHQEVEEQVKSSAPKKPVTPLPTIPPSESTPPPKKSESPVPAQSEQKVAPVPPPQPI
FPPPMSYHDRPPYHTVVKEVIREVQPHRHYCRAKSRHQSKRDTSPVYSDRSGSSCTSKTS
SSSGVASWISDGGYERTFQRQQPPSRHRRPKPQPRQQRSTHRSVPQPSKPPEASTPSHPS
GQCCHSGARNSNCRYRSVCCYSSAHSRARSSITEMSHRGSSKKEQSQQLQQPQQPQQPMI
ILLEAPKQEAPQPAQMAEEQSADDYYDPNSQPQISIVLPPNAQVTPQLSAYTQLQQPQYA
QAPMYYNWSPQYYQGYA
Download sequence
Identical sequences A0A087VYW7
EmuJ_000128200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]