SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000182300.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000182300.1
Domain Number 1 Region: 8-60
Classification Level Classification E-value
Superfamily SH3-domain 1.09e-22
Family SH3-domain 0.00052
Further Details:      
 
Domain Number 2 Region: 61-259
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000000109
Family DBL homology domain (DH-domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000182300.1
Sequence length 739
Sequence
MESAVTTEAQALFDYDRQHFDELSFKTGDIIKVLKEIDGGWWHGELNGTQGWFPSNYVRQ
MLPCSRSTDTSHLLSFQQEIVQHILEGESKQIADLNLLIRILKPNVEVLSKFAFMSKLSI
FVDKLAQIIRLHESVARTLEKMKPLSRPKFVGKLFLNVAKNMDQLAGEYTRSCAYIEFGL
QEGSTTIPVAVGVAGQDLYSTKTKSLFASVHDRLSRYPILLKETERYYEDSHPDRTAICK
AMQVYSEILDRCNLLRNLREVDIEVLSSEIRGLPDQSRPQMNDPTLTLKASICVADADGH
FVIDSSKPQAVLLLYPSFILILSAVAPWVYQFRMHVPISNITVTALQENENVIIVKIVGG
SSPSEEHNLHLWCTGVCTRDLFYSTVTEFIRNSKTVDGAILRQRSATRAAKPGCSGLLRR
RSAGGATDEGGDSGFAAGTGGPHLFALHSSHSGPICGSAADREVEAFDDVPTFSSTSPPP
PPPPRTNTIAVTDLTNLPGCRFLSHEVQTRPLVKWPEDILTMPKRQEVAHSSAFNNPQQN
LQNQQEDRLTHLRLDCTPLQSHCSLISGSSGEMPPRSGARVTLAGGHGNRGSRPNSPGRS
GASGEGRGAAVSAGKVMRRKRTDRQKSAINADDILRSTGHFHEVTQRNEKDAKILQIIEL
YCGSGLPKGALKPLDLTQLRLSCTEMRMKENSLPPPGTTAPVGPTVPPRTYENIDPTPPM
VPFRPPPIILPTSASARKT
Download sequence
Identical sequences A0A087VZY9
EmuJ_000182300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]