SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000203000.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000203000.1
Domain Number 1 Region: 388-457
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000129
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000203000.1
Sequence length 883
Sequence
MDEEVSALHIASFLEHDDELNTKEIMYNLETVLNRSDRTLLECHLRIVDGEYLTVRVEGE
RDPSECFDLCYIDDVHGYSWTHKGAEYPHLFVFRFLARTVTDGEAPNEVHIFSLSDKRIL
HWVIDIVNEGADNAKRVNKQSKPRYQPTRTMSRKKDAISQPERIKRHARESSTGGTKGKL
EELNQLFDEIEGFENLLHDAVSFQVTGANKVDRSLWRDSLTPPSYEAALAHVERIRNCIN
VTADLKDHIKDPGPGELLNRLFESLWWVQKICDGNRVIHYDPNLVRSVWRPAFTDRTISA
LSDYLQAGNKSFWQSLGDAWTVPGGKPDNVNGDFALSTRPTTVERSGFKPEMTIKDYGYY
TMNATPQKKEGEEKIDIESFISGVRARGGTLVIAKQKNVSEAARELSVNVGDILEVLDDS
SEWCCLRTPTGQTGHVPRRCIEVLEENMAGPSRRSLPHDRSKSPREKKISISKRSSATSR
KFKKAPREPDIDISETTSTDENYEGGEYVRQSTPSRTIRHHSCVSCCDGGVHSCHHHHHS
MSPPRQESMAVATSQQYQPMNVQPLQQRPTGQPIIHQGTNGQPSVIVVPSAPSQPAPSRP
PPVHYLVTPPAPAPPPPPPAPQPLIVPMPYPMQQPMMQAPMMAPPTMAPTMMPSPMMQPN
MGSYGIYGPLPRGIPTPMDPFYDGYTNFEGGFRRRPSSSSPRRSTRHKQRGNGRRKKKGD
RSKSGRGSSSSSSSSSSSSRSSSSSSDGTKGRSRGKKHAKSKKSNIPQAPPPPPPPPKED
TYAPHMETMNRELQERMKAMREGNSNGLKPASRRKLDDTWNASQISSNGADPATEIARLA
NKFGTAQVCKLNTSHLRRALWNMSAPLKFSFSPPPRLLTFTLI
Download sequence
Identical sequences A0A087W156
EmuJ_000203000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]