SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000228500.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000228500.1
Domain Number 1 Region: 416-630
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.3e-43
Family Nucleotide and nucleoside kinases 0.00017
Further Details:      
 
Domain Number 2 Region: 272-371
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-25
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 186-289
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000854
Family PDZ domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000228500.1
Sequence length 634
Sequence
MVMLIRTDTADDAEELYRLLSVKPLKPLLLVYSSVISGHIYCAVGEGCTTSGLVHDVCED
LKKSATDGYFSMPEEAEKLLQILSKGYIQALGICMQEIASGNFFAPTLPSLGIYFVEGTV
NSLPRAAYSDFLRGQYSPIYKEQPTGTGKQKSVSANTLPGEGGNSTNSLHYVTGGVKLTG
GGEGPPMKPVCDDDLMLVSFKRNIGEDLGITVGLQEKGASVGYARDVYVKRVMVGSQAER
LGLLGEGDIIREVNGVPIDKPETLQEQIAKSPPTVTLKIIPAHKDPKVKSQLYVRALFTY
DPEKDKLLPCKEAGLRFQCYDILQVLNQSDPNWWQARHYDSSEHAALIPSDTLEERRKTL
VESLPETNAFSYKFFKGLVNSQKTKKTKIIFKAKDFEAFTSKNVCVYEEVALISGFQRPV
ICLLGAPGVGRQTLRDMLIEDNPERYELAVPYTSRERLPGEQDGVDFFFEKAGKMQSGYQ
RNHFIEFGEADGAFYGTKVKTLRRIAQSGKTCLLDCSPSAVSRIRTAEFMPFVVFLAAPS
CNCMKAMYEYGRSMGLTEAWKRLLSKPKRSDHLCSPDEDFRRTLECSQEIERNYRHLFDK
IVICDNIEVTFTRLKKILDDLLVRPQWVSAKWLY
Download sequence
Identical sequences A0A087W155
EmuJ_000228500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]