SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000230300.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000230300.1
Domain Number 1 Region: 14-88
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000394
Family SH3-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000230300.1
Sequence length 500
Sequence
MRRIALIAGDDSHPLHATALASFVGASARELSFQRGSELLLYRRLNEHWWEGQAAAESDG
PRYLVPHLYVKLLVEGTTPPSIPACDPTTTDENTGGVDDDAPPLSTSTLITAPAASSLPK
KPLRHSLTLATTPEFHKGATHGASSTSAESRSVTSPTVCKIEFGNDDVETSLEMDRKDSA
GEDKKIDDTKRHTLTDENEVSDEQESASTSSSPSLITRSMSNSPPPVSPQRRAGNRCSWS
EAPTSSTSATPATSTAPGLETLPEDRLANIKPSLRSSTAEGAEATEPFSTSNGSLIHVDS
GLAEVMHSMASLEDQSRELEQKMRLLSAPKHTPDLVLGLPDRPQPPNWGRTPSSSNEEDS
SGPGKNAADTFAEQAGGTVRKRVSTQLAHFAEPSRPLITSASLSNDLGRSESAPKPVATP
ATWWSTRKLISQAEEESRDGVMSKSFVSENKSVEKENVTTTSATDSPVPIKRGSIAARVA
AFEASTTSSTSARPSWVKKT
Download sequence
Identical sequences A0A087W1M4
EmuJ_000230300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]