SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000237400.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000237400.1
Domain Number 1 Region: 291-513
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-46
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 742-815
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000249
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 519-605,694-727
Classification Level Classification E-value
Superfamily PH domain-like 0.000000131
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000237400.1
Sequence length 847
Sequence
MVVHISCGKKQPKKKGLFYFLCCGCGIEDDSQFIHKTSGEPVRPLRQPSNNLPSDIAGPS
NLPSRPSPPNYFNEPCASVEERRKHFEEVSERRPGRPPILFQRPSVGGSVYTNGSFSAKS
FFAKSLVAEEDELRGNGDRKKVIMRLEDAEKRYDNRLSFKSIFGNAPLYQIYDEHFKRKE
IRRLHHRLRESIRSLRRKKGDQRPLRQPKAIVSPPKFGPDDQSSSSSSSGDEDELKTPSS
AKASSFTVIKRNLSRRRSDVERTAKMGEMNSVANEFSGIGPSRVRWSDMLEVVRLNLAAG
LTKEQHSLQEARFEIITSEASYYKSLTVLIDLFYKAPVFNPIAANAVITEFDKHQLFSNI
LNIHVTSENLLHSLETSFRKDPMMGNICDILYEHSETKLSYYVTYVKNQMYQTRTLSRLM
NRPSFKEAVQNIQSMPQCSGLDLNSFLVLPMQRVMRLRLLVAAVIHYTPRSLPAYESGLV
ALASLEKLIAECNSQKGHMEQKERLVTLSSQLEFKSNLRAVGTDSRELVKEGNLRLLESS
NLPNAAFRRKFSETIKNKPIQITLFLFTDILLVAKRKGEKYLVEDITPVGDLRVTIEALP
EDDMIKRTELKTKINPDDPFHIVPNIRPDRSISVRQSGELMITRQGSHFRERSRSRGGSS
RHRTGSGATGVTSSSSIGSVGGFSEGGVSYIGYPFILTFQSTDFTIVDYHFLCDTLSQRE
RWVNALQPDYYSVPSEISYDTWDCPQVIAIVSYGATEQDELDLKEGDLMNVIVELSDGWL
KGVLPDGRAGWVPKSVCQHVEDPQARRQNMKNFLLSEEAQRAYQKRKQQEKRVDMFVRVH
DLRGTSV
Download sequence
Identical sequences A0A087W205
EmuJ_000237400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]