SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000247300.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000247300.1
Domain Number 1 Region: 1063-1254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-35
Family Nucleotide and nucleoside kinases 0.0000112
Further Details:      
 
Domain Number 2 Region: 190-310
Classification Level Classification E-value
Superfamily PDZ domain-like 8.68e-25
Family PDZ domain 0.0079
Further Details:      
 
Domain Number 3 Region: 511-623
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-24
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 4 Region: 756-832
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-17
Family PDZ domain 0.0049
Further Details:      
 
Domain Number 5 Region: 878-974
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000583
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 6 Region: 4-61
Classification Level Classification E-value
Superfamily L27 domain 0.00000118
Family L27 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000247300.1
Sequence length 1261
Sequence
MHSKRSAERALREIIAFRDGLDKRTDKELIAALDCVVEVMQNHLYHAYLEVRDFYETTLL
STAIPVKVKADMALDIAGRWEQIDKSSSALSTSYTHSDRSSNEPASGVRSRSLSHLPRPV
TLEPGACKRSSAKDRTSVMTSSFGRLDLRRHHHRYEHCLHQQNNNQEQHHPRRVRDNKEP
LFDDNTEASSQSPSFGSVLVSNSSSERRRSFSSIFRVQLTRGPQGFGFSIAGGTDQEPPL
PTIDARFVYVARITPGGVADLDGRLRVNDVILSVNGFGLVGLPHLKAVTIFEQSGAHLDL
KVQRPQSAFAQEISRPVRLPTSPKISSTVSKRVHADRGSGGETNTASVRSRVTALSRSHC
IILPAASNSPSPTESSGPPPTTVSPLSSLITSCQHPPLSASSNAEIPRKKVVGAGMGTAV
TTAVKVAEEERHHNEGDVENEDEDDTVWFFDPEQTGSGRSVLQTTSNTNSRDLDADAASS
NIKVAVEDNALSKPAVESERKRIYQMKKPSSPIVIDQWELSTRPQPDPPPGPIIVEVPLV
RGTSNGFGFSIAGGIGTEFLEGDSGIFITKITSGGVADTSGRIAVGDRLIRVNSVSLVDV
THAEAVEALNTAGDFVLLLLVKVPLQSSPQWINRRHCQETVRNLCILPNPSTNNEGQITD
RHPPLAAAEGFAERGQSHRRRPERRRLMPQQLQSTVLGPSKRTVEALPLSSSSHGSEDYA
AAHAVPESILQRWPRARLVTLYKEEVPMASNGVGGRSGGSLGFNIVSADATDGIYVSHIH
PKGPAASSTAISVGDRLLMVNSTEVVGSTHEEAAILLKTAPSRVDLVLSYAPTEYKKLED
QIRIQTEVRSDDTKGEGDEYDNELATSRLCRSVEADGLFVRVLVNFDPHEVTELNQVIPR
SAISVRSGDILQLINITDREWWQARIIHPSTCKPLGPAGLVPSRCRLEHQERVKWRVLFG
RRSCLLRASSSETSSPLFSDPQSTDKAIESIPLSQSDGPIISSKQSSLPKASASETRSQR
RSTNSSRVSKKSAARRAHSEFTREILPPTYIPVTSMQTVNTRPVVILGDLKHNISEDLLS
EFPDDFSTCVPHTTRHRRRGEVDGRDYHFIKSRSRMESEIQLNRYIEAGEYNGNLYGTHL
HSVFKVASAGFHCLLDVSTMALQRLTAAGLPPIAIFVLSNLPGQSLGSVNRTGAIPKQAK
TVHNRLTKQREKNFTFLREYSPLLTAILIADDYDKITERIHKIVQDNKGPNVWIASSDFL
P
Download sequence
Identical sequences A0A087W1Z0
EmuJ_000247300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]