SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000256700.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000256700.1
Domain Number 1 Region: 576-824
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-68
Family Protein kinases, catalytic subunit 0.00000064
Further Details:      
 
Domain Number 2 Region: 368-462
Classification Level Classification E-value
Superfamily SH2 domain 5.84e-20
Family SH2 domain 0.00087
Further Details:      
 
Domain Number 3 Region: 43-187
Classification Level Classification E-value
Superfamily PH domain-like 4.87e-17
Family Pleckstrin-homology domain (PH domain) 0.0013
Further Details:      
 
Domain Number 4 Region: 321-387
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000293
Family SH3-domain 0.00049
Further Details:      
 
Domain Number 5 Region: 512-589
Classification Level Classification E-value
Superfamily SH2 domain 0.0000226
Family SH2 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000256700.1
Sequence length 836
Sequence
MKNRWRVDGRVDLSGCEICPPIRVTLLAWSLFDMATDQELKISRMTKRSMNKKIFSRPSY
KLREFVLTPFHIKYFEVSGGNRGKEKGRISLAHVKYVEKVLDDDLDNKKNVLQIAYVEDP
SSINWFLLYIVAPTLIERDDWISLIRFYTRERGACFLPRYHPGVWRRPGRYSCCDDINRR
SLGCQHTTDSGSNTEAAEARRFSAFPGCLPPVTSTEVQTPSVPPLGGQQSVAVQAPPPPP
TQVPQQSVVQPIAGKVIMANPPAPPPNPVSMFTQQQLLFQQQQQQQLLLAQQHKLSMLAA
QPHLQQQQQLATRRPARLPQSPGGQSFDWEENEKTVIAVHNYNPVRENQLPLQKGEKYYV
VNDSNAQWWYVRNMAGQSGYVPTNYIHKPNSLNSFDWYYKDITRQQAEAILLEENREGCF
LVRDSVSKKNTYTLSVTSKDPDVAGKLRVHHYHIHRTEAGTNLSNGHANGGGPGVSANGS
AGNSALTNGGNSAGQANGGVNSGTGAGGGGEAQFYLSEKHAFPTISEVIHYHKHNSGGLV
VRLRSPPVKDRESPVTAGMGLDEFELDPAELQIDPEPIGKGQFGVVKRGKFRNIPVAVKQ
MVENAMNEEDFIEEAKNMRFLNHPNLVQLFGVVLKKRPIMIITEYMKYGSLRDFLRQRQS
QFCNRPVVLADICAQVGNGMAYLEREQFVHRDLAARNCLVKSVSRNSVVVKVADFGMARF
LLDNVYEPSAGTKFPVRWAAPEVFQSVYTDKADVWSFGVLMWEVFTYCLENPYHGMNNSQ
VYQFIVDGGRLHKPAVCPDRIYVLMLECWQHDRNRRPAFEYICQKIGDYLDQNCEN
Download sequence
Identical sequences A0A087W2D2
EmuJ_000256700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]