SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000312900.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EmuJ_000312900.1
Domain Number - Region: 76-120
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0097
Family Protein kinases, catalytic subunit 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000312900.1
Sequence length 167
Sequence
ELDDYSSKPGTACPSRRHRTIAMPDQFNRLNVRTAEKGPLSGGSNKRAGIQRKFSEDGLE
SADSGNYSGHSERGSVPDNYVVAVKAESNTQSKQMLHMEVAVLRRLKGRKNFCDLITCAQ
LVKDFHSRWLQGTFSTSTSSLKTHSPVDITLEIEMIKKPFTSKQFRM
Download sequence
Identical sequences EmuJ_000312900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]