SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000333400.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000333400.1
Domain Number 1 Region: 73-264
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-16
Family DBL homology domain (DH-domain) 0.0013
Further Details:      
 
Weak hits

Sequence:  EmuJ_000333400.1
Domain Number - Region: 511-584
Classification Level Classification E-value
Superfamily SH3-domain 0.000166
Family SH3-domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000333400.1
Sequence length 585
Sequence
MHVGHEASRSDLLFPNMDFVNHKSSPPPLPPKYAPRRQQPPPTPRRQAFQGNGFRVGPAG
FSASCSNYKMDETMENQRTNAVRELIENEKLFKKQMTLVSEIMTKNRVPVSITPADLAAV
KLNLDDYIYTSAQMIRAYENAVAEAPNGKLAYACVCKHLVPTLPAFRNVMVAYIKDYDPE
ILQHRPHLVEYFDKAGELLHRLEGQMVILSDRLLKPFQRPFHITCILHRLDKYTPELHPD
SGYVKQAKIAIQKACDDAEEAKRADGDYKQYDDFPQLTVDVSAGNSAAGGAFENSRMTNY
RKKGKKLSLLIEDLSKWIKLNSEDLKSFIENRRLLIKAVRELLESLDSAAGSSLPLNFHA
SSVQHQIRIFDPTMFNRASEEVLDRLKLLTAPLKKMKPSLKKLKSRANDIAKTQRNRTAN
PATIDAYRRDEKKAMALSEAILGKTEKAIKALFLHYLSHVQRLFNYAAIKENGLDERYTK
ALVRLREADLKSQVEVIIAIWERQSKVSQGSNPRPNTKDAPTPARCKARIVYHYSDHQTP
PNLQVNDVVYVFRWTDAMGNPEWAEVSDRTGRRFFYPSSRLERLS
Download sequence
Identical sequences A0A068XTQ4
EmuJ_000333400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]