SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000342000.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000342000.1
Domain Number 1 Region: 183-368,398-484
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.41e-56
Family Protein kinases, catalytic subunit 0.00000336
Further Details:      
 
Domain Number 2 Region: 66-216
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-26
Family SH2 domain 0.00057
Further Details:      
 
Domain Number 3 Region: 9-87
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000276
Family SH3-domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000342000.1
Sequence length 535
Sequence
MPNSALQENVIAVYRYEKTSNEDLQFEKGEHLAILRRLTDGNWALARNGKGQTGLIPLNF
VESDVDPPWLHGQISREEAELLLQDEPPGSFLVRASSRFVGDYTLSLVGGHSSEDNSYAT
KVSPTQHYHIYSVNGLDGSVPSEFFSLDNKEMFPSLRKLVEHYKVVDRGLAHPLTAPVVD
MERVCMQRLRDRHWIPREHLTLGQKLGHGEFGEVLRAKIGDREVAVKRYKASAKRQLIYE
ACIMSELKHENLLELLGVTEEPDEDETVVADSVPCTTFCLVTEFSPLGSLLFYLRSRGRA
LLGPATLLSFATDVARGLVYMEARSYLHCDVAARNVLLFSSAKHPRYPVAKLGDFGLAFR
LRSSSPIFDHRVTGEVDFDAVKRPTCVGPLCFTGTQRMSSITRIPIKWTAPESIRTRIFT
HKSDVWSFGVMLWELYSFGRLPYPRLMTSQVLAHLEAGERMEAPQDCPKGVYSLMTETFS
RGFSKSPCSSMVIVVLPSDRSAENVSISPSEDDVNIILMCISFSPLHYRITAPYY
Download sequence
Identical sequences A0A068Y1M1
EmuJ_000342000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]