SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000344500.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000344500.1
Domain Number 1 Region: 36-174
Classification Level Classification E-value
Superfamily EF-hand 5.91e-42
Family Calmodulin-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000344500.1
Sequence length 227
Sequence
MTQRPTGTAKENTKKARKSPMPASRGKENGECGVSKELHDAFVFFDVNHDGRITESELNS
VLSFLGVKTSASEVKRMIADADIDGNGTVEYNEFIRMMNRYSEKTANCPDAEMLEAFRVF
DRNNDAYIDHEEIKRTMHLLGETVSDDDVRAMIKEADADHDGLVDFEEFKRMMELKIDAD
CSQETRKTKFCFAQIHSFLNLYHLLSSLLLLLLSIYLSTIPLTDLLF
Download sequence
Identical sequences A0A068XVV4
EmuJ_000344500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]