SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000346900.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000346900.1
Domain Number 1 Region: 33-188,256-355
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-27
Family FCH domain 0.014
Further Details:      
 
Domain Number 2 Region: 983-1037
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000184
Family SH3-domain 0.0012
Further Details:      
 
Weak hits

Sequence:  EmuJ_000346900.1
Domain Number - Region: 470-523
Classification Level Classification E-value
Superfamily HR1 repeat 0.00405
Family HR1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000346900.1
Sequence length 1038
Sequence
MRSGAILQCSPTGAREHLSLKCRHRQCVSLESHSFMDRTGFDILQKEFKSSCKFTRVLIS
ILQERVQLENDYAKGLSKLHSRLSKSAVGLSGSVANGWIQTMENLEFEAKAHQDLAEKIV
SQLLPTSKAFITAADRDLKPVSSEVDAATSRLQTARREEFKSRKKAFTAYCLTCQNLSTN
NNTSSSLDGGNCVGGIDLARRTSTLLLRNRTLRYPSNPITSSSTNSPFKIAMQSASLRRV
ATLSTTQPSMEMSSTLERHSALPAKAVRSVWRAVLDLYHSNLASEEARIEWHSTLYQNSS
KLFDLERLRLRTMQETLESYLSAVRESIQSIEKAFQATKDTLAKTSAEEDFLSFYGRAVV
DLNTISHYTSHSPLSASRLSNSKVLHGVDKTQPLAVMGSTQQNLLCLPGEEDSLYTSSKE
MQRQTIRQALQKRFLIFPKEEPEFSNEVLADSARRSERAAFARHLIMSVLNVLVRECQKE
ERTKQGLTNLVQVYSTGPIFTDDATLIEARRRLFSSRCRLAHLLACRARFACLFHLLSPD
SSSHSSSLQNRLSEAGFSVDSTLTYRRADVVAPLTPPSILLEWPPVSSEVVNLENVPVSD
LEVINPLIANDMSRFSWMAHADSLFFASDSIGGASSSLTDEVEIEKDEEGLKGEKVEATE
LPKLPPIVVNGSVARAENGKKKSPVKSRIDRFPMRSAGSVSRRNFPPSSSTNTSKLVTTP
SVQKNATAAKLQTPSKFRTLPKTTDQPIRPPLLTITSKASITRQPFVITTREPERKLTSS
KTTKDAPKTVVSNSKSRPMLKFRSKSVPKAPSTTTVPAFSPVLDDTDAFMDDDAEDEGEK
RENEGQPSVVPSWQAVMQEKRRITLERVNGCGDALVGKEKVDRVEQEGGKEKGGEEEKLK
LKNRVDKKTNVTTFFSRLGIRNTKQQKHQQRPVIVTPWRSEPSNGDPASFTPSASGGITA
SSPARETNNPLHMWPSLASLHCIGWAKVTSDYTPQKSGELALLEGEIVSILQKTTTTWWI
GEIGGKSGRFPVSHVEEF
Download sequence
Identical sequences A0A068XVM3
EmuJ_000346900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]