SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000436900.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000436900.1
Domain Number 1 Region: 201-501
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-62
Family Protein kinases, catalytic subunit 0.0000912
Further Details:      
 
Domain Number 2 Region: 56-122
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000499
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000436900.1
Sequence length 1518
Sequence
MAFFQLRRIEPAAFWQPQSPRVTTSIEYRSIGCSYARSCGKNSSIMSAITASISRPQSSS
HRAVALLKYRPKCDDELCLTTGQAVQVLSIDPKVSGSEGWWVGQDSYGKVGVFPANYVQL
QVASPESDDNRLQSYCNLSEGHNSSLRDSSCSFPMDGTLVPNSVPTPLLLTDSVRGTGDG
DGDFRIRQNGKVDDLKESLSHLRVIKFEDIKLGESIGAGSFGTVYRGTWQEKTVALKVYH
QASSQIQREAFNLGQLAHRNVVEFFGLWETQETISHLPALVMEFAHGGALHTVVRRRPTI
RPLTLADWALQIAEGMRYLHECAGLVHRDLKTANILIREPLVASPGPDDLIRKTLIISDF
GMSCPTDIIDSCVSGVGTAAYAAPEVICMAIFSLASDVWSYGVVLWEIFTMLEPFQEFDR
AQQLVNIGRYRQKLFIPRPEAGFPEVIGTLLASCWADERTDRPTFCDIYNRIMDAQHDSF
FSLSTEEFTALQSAWIREISDEAELSLLSESCSSEASSPLRRQNEYLQQENAKMRDALQT
LQQNEVRYRGTIAGLQKDNQILSVLVANTLYNNAAPAPRKRPFIYNPFRRNEQKTSAVNL
ASVLSGEGESPSATTTAAVGAGVVTTTECSPRDYSPAVKSTGRRYGGRKTSKSGLGISYP
SDVRHVFHVPCNLVFESNNDLYSPIYRSNFSPGSYNTFVGPSIPSPTSPTIYASGSASSS
SYLRPRTESQSTDPPVHPSSIVFSPTEDAADIARHFAFLYAQNGLTGATPLLTQITSQTL
QQKHQRFPKFSGTEGLTSYKSAPELCEKIRCSKARLNTLEGRHTVSRSSAFDPTDTPADR
KPTTLSTSGANGSVNTSKRHRIGLSALFHTSRSKHNSGSGKPPSPACESVPLSPLPPSVP
TPASDLSPSSTLSGTASQSGRGSGKRKSLSTTPRRLLLHKLFQTERNKQRRVSAGSRKSS
GLTKKQRDSVSPDSSPILPEGNVQSSPDLENRKVVIEPPHCNYVSATVQIPPLPPYLLRQ
SNHTLGPRRRLLDIIPPPPAYLPTAAASIPRPCTLSATSDGETKSGVRRRPFVLRTKSQS
LDILYQPEEAMAMEAKGKESNETEAEGEDDEGEETGGVASVNPVPLALWSALHVASIAPL
LLDCNPAAPVRSYPPTAPHSASFARVTFSPFTADESNHAAGVLGKAQSCLGRISSTLALT
TVSVDRSRQPTRQQWNTQRELSAPAPSSSPWQRKLNNLSPVYYSPPSGSGGAGRGDGSSG
GGGGSGQEPCCKCVCHSAGGGSRQSSSATTTTTSSQSSSPWLPVDNPVALSRDAYLKVTQ
DGYLNRSVVGEALDDDDDDDGIDMTSGMRSTSSVLLSRSLCGFSPSPLFSPTSFLQQQQQ
QRHSSNSPPTSFLDSSGVAVDPGDQVIILPEEEEEETGELSFGAGEAAEDTDTLYAEFQT
LPHQALYKTVYDRKLDGDWCNGRAPIPEPEVLSTEFPSYPCRRRKAFRMKDKPEGLLSSP
EDDSTNGTGGNPTIPAAP
Download sequence
Identical sequences A0A068XY33
EmuJ_000436900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]