SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000444100.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000444100.1
Domain Number 1 Region: 370-556
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.24e-37
Family Nucleotide and nucleoside kinases 0.0000149
Further Details:      
 
Domain Number 2 Region: 115-163
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000021
Family SH3-domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000444100.1
Sequence length 570
Sequence
MSSVSSPDKSSRRTYSSLSCVSKRPDSSIFDSVGVEPLRVIKRPTIGVAHSNQHLFNHRG
SGATLDDASSLADQSSSAVSPVKLTSSKSSLTGTSASQSDLVGINYKLTTLTINQRESIY
VRALFRYDPTTDRGLAARGLAFEHGDILYVVNASDQEWWQACYAFPISPPAWASACTSNT
AISSNSITPLEVPSSYNANIPDQQPPTRSCRPAIIPSQRRVERRSRLSAKRVKFVDKEVD
IGEGSPNPWSPSGGDTSNLSYALESHRFFGGSGGCGVEGSSVSLSAVASCGGGSFPSGDS
VSVGGTLERRKKPNSFSIFKRFSSKRDRKDFDGGTIMKKKSVSLEDMQTGSFGPRLSRTY
EIVHSVTLKMARPLIIFGPLKERITEELLRSDEFATCIQHTSRPPEADEVDGVDYHFYSS
KAAMQADISSGKFLDVIVQSDHFYATSMQSILEVLQSGRICILDVNIVAIYRLQSAGLHP
MSILLKPETVMQCRGLQRRLTVDQARRMHEACTRMESEYWYLFTAILNLESLDSALVSVN
RVLQQHKGPCVWLPADQTLRSVEKQTPTLI
Download sequence
Identical sequences A0A068Y4J7
EmuJ_000444100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]