SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000447600.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EmuJ_000447600.1
Domain Number - Region: 183-289
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00158
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000447600.1
Sequence length 335
Sequence
MAEWFHSTCGHTKMALNSSANTHPSKFIESLTYESKLLKSGNGTALENSMMNLANSDRRL
LEMRKKFRSEIAESKKKREDLAVRQEDLRYQMKRFEGFIRDNEAKRVRAVKKYLTERQII
EEKTREGVELRVEFGKAKIAYENMRRKVEEYKKYESYLLDVIDLLPPDYIKIADNVLVGL
IMRYNTLYGTYQSLLAEMNTKSKNIREAHTHLQALREEHASRILTLNSKLADLYKERAAN
NEQLQQLVQKFDQGHKDLRKQLELFGTVIRSVENLVDKCGWPYTTAVEENETLCTKLVRI
TEYIVTVRMILAAINANSGKAERKQPPKNSGTTPE
Download sequence
Identical sequences A0A068Y4Y0
EmuJ_000447600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]